KEGG   Mus musculus (mouse): 67223Help
Entry
67223             CDS       T01002                                 

Gene name
Rrp15, 2810430M08Rik, 5430437H21Rik
Definition
(RefSeq) ribosomal RNA processing 15 homolog (S. cerevisiae)
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Rrp15p MctB
Motif
Other DBs
NCBI-GeneID: 67223
NCBI-ProteinID: NP_080317
MGI: 1914473
Ensembl: ENSMUSG00000001305
Vega: OTTMUSG00000034905
UniProt: Q9CYX7
Position
1; 1 H5
AA seq 281 aa AA seqDB search
MAAAVQDSRVSPGEILKRSPKKKKKMKMVAKAAASKLEDEVKDSSDGEGSCDSEMDHSDD
GAAEADSEDNVESCEEDNEDAAESSAGTNSGWADAMAKILNKKTPKSKATILTKNKELEK
EKEKLKQERLEKRKQLDKKREWEMLCRVKPDVVKDKEAERNLQRIATRGVVQLFNAVQKH
QRNVGEKVKEAGGSVRKRAKLMSTVSKKDFISVLRGMDGTSRNSPAGKSPKARQTEVKSE
ESPGWKILRDDFMMGASMKDWDKESEGEEPAGGRAEAAASR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggccgttcaggactcacgtgtgagcccaggggagatactgaagcgttctccg
aagaagaagaaaaagatgaagatggtagccaaggctgcagcgtcgaagctagaagatgag
gtcaaagactcttctgatggagaaggaagctgtgactcagagatggaccactcagatgat
ggagctgcagaagcagacagtgaggacaatgttgaatcctgtgaggaagacaatgaagac
gccgcagagtcgagtgctgggaccaattcaggctgggcagatgccatggcaaaaatcctt
aacaaaaagactcctaaaagcaaagccaccatcctcaccaaaaacaaagagctggagaag
gagaaggagaagctaaagcaggagaggctggagaaaaggaagcagcttgataagaagcgg
gagtgggaaatgctgtgcagagtgaagccagatgttgtcaaagacaaagaggcagagagg
aaccttcagaggattgcgacaaggggtgtggtgcagctcttcaatgctgttcagaaacac
caaaggaatgttggcgaaaaggttaaggaagcaggaggctccgtccgcaagcgagccaag
ctgatgtcaactgtttccaagaaggatttcatcagtgttcttcgaggaatggatggtaca
agtaggaacagtcctgctgggaagagccccaaagccagacagactgaagtgaaatcagaa
gagagcccagggtggaagattctgcgagatgatttcatgatgggagccagcatgaaggac
tgggacaaggagagcgagggcgaggagcctgctggtggcagggcagaggccgcagccagc
cgttga

DBGET integrated database retrieval system