KEGG   Mus musculus (mouse): 67225
Entry
67225             CDS       T01002                                 

Gene name
Rnpc3, 2810441O16Rik, AI447568, C030014B17Rik
Definition
(RefSeq) RNA-binding region (RNP1, RRM) containing 3
  KO
K13157  U11/U12 small nuclear ribonucleoprotein 65 kDa protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    67225 (Rnpc3)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Minor spliceosome components
   Minor spliceosome specific factors
    67225 (Rnpc3)
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 67225
NCBI-ProteinID: NP_001033785
MGI: 1914475
Ensembl: ENSMUSG00000027981
Vega: OTTMUSG00000022379
UniProt: Q3UZ01
Position
3; 3 F3
AA seq 514 aa
MAGPEPPMPLSRGGPGSASLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSD
KGRLKHTAFATFPNEKAAIKALTRLHQLKLLGHTLVVEFAKEQDRVHSPCSTSNTEKKKR
LDDTVENDKEKKEPDILTVENGIAPNHGLTFPLNSCLKYMYPPPSSTILANIVNALASVP
KFYVQVLHLMNKMNLPTPFGPITARPPMYEDYMPLHAPLPPTSPQPPEEPPLPDEDEDLS
SKESEYESSDEEDRQRMNRLMELANLQPKRPKTEKPRHVRKKRKIKDMLNIPSSASHSLH
PVLLPSDVFDQPQSVGNKKIEFNISTNMPAAFNKDLETQPNNEEENSDSPDTGLDSNTGF
GKIFPKPNLNITEEITEDSDEIPSQFISRKELEKGRISREEMETLSVFRSYEPGEPNCRI
YVKNLARHVQEKDLKFIFGRYVDFSSETQRIMFDIRLMKEGRMKGQAFVGLPNEKAAAKA
LKEANGYVLFGKPMVVQFARSARPKQDSKEGKRK
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggcggggcctgagccgccgatgccgctgtcccgaggcggcccaggctccgcttcgctt
tctccgccccggggagaccgcaccctcctcgtcaggcacctgccggccgagctgacggct
gaggagaaggaggacttactgaagtacttcggggcgcagtcggtgcgcgtcctgtcagat
aaggggcgcctgaaacacacagcatttgctactttccctaatgaaaaagcagcaataaag
gcactgacgagactccatcagctgaaacttctaggtcatactttagttgttgaatttgca
aaagagcaagatcgagttcactccccatgttccacctcaaatacagagaaaaagaaaagg
ttggatgacactgtggaaaatgataaagagaagaaagaacctgacattttaacagtagaa
aatggaattgcaccaaatcatgggctgacttttcctctgaattcatgccttaaatatatg
tatcctccaccatcaagcacaatcctcgcaaatatagtaaatgctctggcaagtgtccca
aaattctatgtacaggtgcttcatcttatgaataaaatgaatttgcccacaccatttgga
ccgattactgcacgacctcctatgtatgaggactatatgccattgcatgcaccccttcca
cctacatcccctcaaccgcctgaggagcctcccttaccagatgaggatgaggatttatct
agcaaagaatcagaatatgaaagcagtgatgaggaggaccgacagagaatgaacagatta
atggaactagcaaatcttcagcccaaaagacccaaaacagaaaagccacgccacgtgaga
aaaaagcgaaaaataaaggatatgttgaatataccttcatcagcttcacatagtttgcat
cctgtgctgttaccttcggatgtatttgaccagccacaatctgtaggtaataaaaaaatt
gagttcaatatatcaaccaacatgcctgcagcatttaacaaagatttggagacacaacca
aataatgaagaagaaaattctgattcaccagacactggacttgattcaaatacaggattt
ggcaaaatcttccctaaacctaatttgaacatcacagaagagattacagaagactctgat
gaaataccttcacaatttatttctagaaaagagttggaaaagggtcgtatttctagagaa
gaaatggaaacactttcagtttttagaagttatgaacctggtgaaccaaactgcagaatt
tatgtaaagaatttagctagacatgttcaggaaaaggaccttaaatttatatttggaaga
tacgttgacttttcttcagaaacacagcggatcatgtttgatattcgcttaatgaaagaa
ggacgcatgaaaggacaagcttttgttggacttccaaatgaaaaagcagccgctaaagcg
ttgaaagaagctaatggctatgttctttttggaaaacccatggtggttcagtttgctcga
tctgctagaccaaaacaggattctaaagaaggaaaacggaagtga

DBGET integrated database retrieval system