KEGG   Mus musculus (house mouse): 67263
Entry
67263             CDS       T01002                                 
Symbol
Zswim6, 2900036G02Rik, mKIAA1577
Name
(RefSeq) zinc finger SWIM-type containing 6
  KO
K25704  zinc finger SWIM domain-containing protein 6
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    67263 (Zswim6)
Cilium and associated proteins [BR:mmu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   67263 (Zswim6)
SSDB
Motif
Pfam: DUF6247 SWIM
Other DBs
NCBI-GeneID: 67263
NCBI-ProteinID: NP_663431
MGI: 1914513
Ensembl: ENSMUSG00000032846
UniProt: Q80TB7
Position
13:complement(107861152..108026598)
AA seq 1207 aa
MAERGQQPPPAKRLCCRPGGGGGGGGGGGGSSGGGAGGGYSSACRPGPRAGGAAAAAACG
GGAALGLLPPGKTQSPESLLDIAARRVAEKWPFQRVEERFERIPEPVQRRIVYWSFPRSE
REICMYSSFNTGGGSAGGPGDDSGGGGGGTGGGAGGGGGSSSSPAATSAAAAAVAAGTGT
PSVGAASAADGGDETRLPFRRGIALLESGCVDNVLQVGFHLSGTVTEPAIQPEPETVCNV
AISFDRCKITSVTCSCGNKDIFYCAHVVALSLYRIRKPEQVKLHLPISETLFQMNRDQLQ
KFVQYLITVHHTEVLPTAQKLADEILSQNSEINQVHGAPDPTAGASIDDENCWHLDEEQV
QEQVKVFLSQGGYHGSGKQLNMLFAKVREMLKMRDSNGARMLTLITEQFMADPRLSLWRQ
QGTAMTDKYRQLWDELGALWMCIVLNPHCKLEQKASWLKQLKKWNSVDVCPWEDGNHGSE
LPNLTNALPQGANANQDSSNRPHRTVFTRAIEACDLHWQDSHLQHIISSDLYTNYCYHDD
TENSLFDSRGWPLWHEHVPTACARVDALRSHGYPREALRLAIAIVNTLRRQQQKQLEMFR
TQKKELPHKSITSITNLEGWVGHPLDPVGTLFSSLMEACHTDGDAFSGFSDCTDNMGQCK
SLEYHHLPAHKFLEEGESYVTLAVEVALIGLGQQRIMPDGLYTQEKVCRNEEQLISKLQE
IELDDTLVKIFRKQAVFLLEAGPYSGLGEIIHRESVPMHTFAKYLFTSLLPHDAELAYKI
ALRAMRLLVLESTAPTGDLSRPHHIASVVPNRYPRWFTLSHIESQQCELASTMLTAAKGD
VRRLETVLESIQKNIHSSSHIFKLAQDAFKIATLMDSLPDITLLKVSLELGLQVMRMTLS
TLNWRRREMVRWLVTCATEVGVYALDSIMQSWFTLFTPTEATSIVATTVMSNSTIVRLHL
DCHQQEKLASSARTLALQCAMKDPQNCALSALTLCEKDHIAFETAYQIVLDAATTGMSYT
QLFTIARYMEHRGYPMRAYKLATLAMTHLNLSYNQDTHPAINDVLWACALSHSLGKNELA
AIIPLVVKSVKCATVLSDILRRCTLTTPGMVGLHGRRNSGKLMSLDKAPLRQLLDATIGA
YINTTHSRLTHISPRHYSEFIEFLSKARETFLMAHDGHIQFTQFIDNLKQIYKGKKKLMM
LVRERFG
NT seq 3624 nt   +upstreamnt  +downstreamnt
atggcggagcgcggacagcagcctcctcccgcgaaacggctctgctgccggccgggcggc
ggcggcggcggcggcggcggtggtgggggcagcagcggcggcggcgcgggtggcggctac
agctctgcctgtcggcccggcccgcgggcgggcggtgcggcggcggcggcggcgtgcggg
ggcggcgcggcactggggctgctgccgccgggcaagacccaaagccccgagtctctgctg
gacatcgcagcgcgcagggtggcggagaagtggccgttccagcgcgtggaggagcgcttc
gagcgcatcccggagccggtgcagcgccgcatcgtctactggtcctttccccgcagtgag
cgggagatctgcatgtactcgtccttcaacaccggcggcggctccgcgggcggccccggc
gacgacagcggcggcggcggcggcggcacgggcggcggcgcgggcggcggcggcggctcc
tcatcctcgccggccgccacctcagccgccgccgccgccgtcgccgcgggcaccgggacc
ccgtcggtgggggcggccagcgctgcggacggcggcgacgagacgcggctgcccttccgc
cggggtatcgcgctgctggagagtggctgcgtagacaacgtcctgcaagtcggtttccac
ttgagtggcacagtgacagaacctgcaatacaaccggagccagaaaccgtttgcaacgtg
gccatcagctttgatcgttgcaagattacctcagtgacctgcagctgtggaaacaaggac
atattttattgtgcccatgttgtggcactgtctttataccgcatccgcaagccagagcag
gtcaaactgcatcttcccatttcagagactctctttcagatgaacagagaccagctacaa
aagtttgttcagtatttgatcacagtgcaccacacagaagtcttgccaactgcacagaag
ctagcagatgaaattctctcccagaattcagaaatcaaccaagttcatggtgctcctgat
cctacggcgggtgctagtattgacgatgagaactgctggcacttggatgaagagcaggtg
caagaacaggtgaaagtgttcctctcccagggagggtaccacgggtcaggaaagcagctc
aacatgctctttgcaaaggtgcgggagatgttgaagatgagagactccaatggggcccgt
atgttgaccttgatcacagagcagttcatggctgaccctcgcctgtcactttggaggcag
caaggcactgcaatgactgacaagtataggcagctctgggatgagcttggtgctctgtgg
atgtgtatcgttttaaacccccactgtaagttggagcaaaaagccagttggctaaagcaa
ctgaaaaaatggaacagtgttgatgtctgtccgtgggaagatggaaatcatggcagtgaa
ttacccaacctaaccaatgctctgcctcagggtgcaaatgccaaccaagattcatcgaac
aggcctcatcggacagtgttcacgagagccatcgaggcatgtgatctccactggcaggat
agccacttgcagcacattatcagcagtgacctgtacaccaactactgttaccatgacgac
actgaaaactccctctttgactcccgggggtggcccctctggcatgaacacgtccctaca
gcctgtgcaagagtggatgcgttgcgttctcacgggtaccccagagaagcactgagacta
gcaatagctattgtgaacacattacgacgacaacagcagaaacagttggaaatgttccgg
actcaaaaaaaagagctgccccataaaagcataacttcaataaccaatctggaaggctgg
gttggacaccccctggaccctgtgggcactctcttcagtagccttatggaagcttgccac
actgacggtgacgccttctctggcttctccgattgtacagacaacatgggacaatgcaag
tccctggagtaccaccatctgcctgcacacaagttcttagaagaaggggaatcctatgta
accctggctgtggaggtggccctgatcggactgggacagcagcggatcatgcctgacggg
ctgtacacacaagagaaggtttgccggaacgaggagcagctcatctctaagcttcaggaa
atcgaattggatgacacactggtgaaaatttttcgaaagcaagcagtcttcctattagaa
gctggaccatatagtggcttaggtgaaataatccatcgggagagtgttccaatgcacaca
tttgccaagtatctcttcacctctctcctacctcatgatgctgaattagcatacaaaatt
gcactgagagcaatgcggttactagtattggaatctactgctccgacaggagacctctcc
cgcccccaccacattgcgtcagtcgtccccaaccgataccctcgctggttcactttgagc
cacattgagtcccagcagtgtgagctggcatccaccatgctaactgcagccaaaggcgat
gttcggaggctggagacagtattagaatccatccagaaaaacatccactcctcatcacac
atcttcaagcttgcccaagatgcatttaaaatagcaactctcatggacagcttgccagac
atcactcttttgaaagtgtctctggagctgggcctgcaggtcatgcgaatgaccctgtca
accctcaattggcgacgtcgagaaatggtgcggtggctggtgacatgtgctactgaagtg
ggcgtttatgccctggacagcatcatgcagagctggtttacacttttcactcccacggag
gccacgagtattgttgcgactaccgtgatgtccaacagcaccatagtccgcctccacctg
gactgccatcaacaggaaaagctggccagcagtgcccggacgctggcattgcagtgcgcc
atgaaggacccgcagaactgcgccctctctgcactgaccctctgtgaaaaggaccacata
gcttttgagacggcgtaccaaatcgtccttgatgctgctaccaccggcatgagctacaca
cagctctttacaatagcacggtacatggagcaccgtgggtacccgatgagggcctacaag
ctggccacgctggccatgacccatctcaacctgagctacaatcaggacacacaccctgcc
attaatgacgttctgtgggcctgtgcgcttagtcactccctcggtaagaatgagctagca
gctataatacctctggtggttaagagcgtcaaatgcgcaacggtactgtcggacattttg
cgcaggtgcaccctgaccaccccgggcatggtgggacttcatggaaggaggaactctggc
aagctcatgtcactggacaaagcccccttgcggcagctcttggatgccacgatcggggcc
tatatcaacacaacgcactcacgcctcacacacatcagtcctcggcactatagcgagttt
atcgagttcctcagcaaggcccgagagaccttcctaatggcacacgatggacacattcag
tttacacagtttatcgacaacctgaaacaaatctacaaaggcaaaaagaagctgatgatg
ttggttcgggagaggtttggttga

DBGET integrated database retrieval system