KEGG   Mus musculus (mouse): 67267
Entry
67267             CDS       T01002                                 

Symbol
Uqcc2, 2900010M23Rik, Cbp6, M19, Mnf1
Name
(RefSeq) ubiquinol-cytochrome c reductase complex assembly factor 2
  KO
K17682  mitochondrial nucleoid factor 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    67267 (Uqcc2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    67267 (Uqcc2)
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-III assembly factors
    67267 (Uqcc2)
SSDB
Motif
Pfam: Complex1_LYR
Other DBs
NCBI-GeneID: 67267
NCBI-ProteinID: NP_080339
MGI: 1914517
Ensembl: ENSMUSG00000024208
Vega: OTTMUSG00000031358
UniProt: Q9CQY6
Position
17; 17 A3.3
AA seq 136 aa
MAALRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQIAEPEACDQMYESL
ARLHSNYYKHKYPRPRDTSFSGLSVEEYKLILSTDTLEEFQEMNKSMWKKLQEKFAPTRP
EEKHKAWTRVLSRPRT
NT seq 411 nt   +upstreamnt  +downstreamnt
atggccgctctccgctaccggcgtttccttaagctctgtgaggaatggccagtggacgag
accaaacggggccgggacttgggcgcttacctgcggcagcgggtagcgcaggccttccgg
gagggagagaacacccagattgcagaacccgaggcctgtgatcagatgtacgagagctta
gcacgactgcattcaaactactacaagcacaagtaccctcgccccagagacaccagcttc
agtggcctgtccgtggaagagtacaagctgatcctgtccacagacactttggaagagttc
caagagatgaataagagcatgtggaagaaactgcaggagaagtttgcgcccaccaggcct
gaggagaagcacaaggcctggactcgggtcctgtcccgcccacggacctga

DBGET integrated database retrieval system