KEGG   Mus musculus (mouse): 672682
Entry
672682            CDS       T01002                                 

Gene name
Muc21, Gm9573, epig
Definition
(RefSeq) mucin 21
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Epiglycanin_C
Other DBs
NCBI-GeneID: 672682
NCBI-ProteinID: NP_001231583
MGI: 3779983
Ensembl: ENSMUSG00000090588
Vega: OTTMUSG00000037249
UniProt: F7C950
Position
17 B1; 17
AA seq 1606 aa
MQRRSSLWCWLLLQILLLGSGYAHISSTTTSNPSSETKSIATDYETTPTTTISSTASGSM
PTLTTKASSIASDSKPTLTTTASSTASGSMSTPTTPASSTASGSTPTTTTTASSTASGST
PTPTTPASSTASGSTPTPTTTASSKASRSVPTTVSSTGSGSTPTPTTTASSTASGSTPTL
TTTPSSTASGSTPTPTTPASSTASGSSPTPTTPVSSTASGSTPTPTTTASSKASGSVPTT
VSSTGSGSTPTLTTTVSSTVSDSTPTPTTTASSTASGSAPTPTTTASSTASGSTPTLTTT
ASSSGSGSTPTLPTTESSTASGSTPTRTTTTSSTASRSTPTPTTTASSTASGSTPTPTTT
VSSTGSGSTPTLTTTASRSGSGSTPTLTTTESSTASGSSPTLTTTASSSASGSMPTPTTT
ASSTASGSSPTLTTTASSSASGSMPTLTTTASSSASGSSPTLTTTASSSASGSMPTPTTT
VSSTGSGSTPTLTTTESSTASGSTPTWTTTTSSTASRSTPTPTTTASSTASGSTPTPTTT
VSSTGSGSTPTLTTTASRSGSGSTPTLTTTESSTASGSIPTLTTAASSTASGSTPTPTTT
ASSTASGSMPTPTTTASSTGSGSTPTLTTTASSSGSGSTPTLTTTESSTASGSIPTLTSA
ASSSASGSMPTPTTTVSSTGSGSTPTLTTTASSSASGSMPTPTTTASSTASGSSPTLTTT
ASSSASGSAPNPTTTVSSTGSGSTPTLTTTASSSGSGSTPTLPTTESSTASGSTPTRTTT
TSSTASRSTPTPTTTASSTASGSTPTPTTTVSSTASGSTPTLTTTASRSGSGSTPTLTTT
ESSTASGSTPTPTTTASSTASGSAPNPTTTVSSTASGSTPTLPTTASSSGSGSTPTLTTT
ESSTASGSSPTLTTTASSSASGSMPTPTTTASSTASGSSPTLTTTASSSASGSMPTLTTT
ASSSASGSSPTLTTTASSSASGSMPTPTTTVSSTGSGSTPTLTTTESSTASGSTPTWTTT
TSSTASRSTPTPTTTASSTASGSTPTPTTTVSSTGSGSTPTLTTTASRRGSGSTPTLTTT
ESSTGSGSTPTLTTTASSSGSGSTPTLPTTESSTASGSTPTRTTTTSSTASRSTPTPTTT
ASSTASGSTPTPTTTVSSTASGSTPTLTTTASRSGSGSTPILTTTESSTASGSTPTLTTA
ASSSASGSTPTPTTTVSSTGSGSTPTLTTTASSSGSGSTPTLTTTESSTASGSTPTQTTT
TSSTASRSTPTPTTTASSTASGSIPTPTTTASSIASGTTPTLTTTESSTASGSSPTPTTA
SSSSASDSKPTSTTTASSTVSDSTPTPTTNASSSASGSTPTQTTTASRSASGSVPTLTTI
AFSTASGSTPTLTTTASNSASSSSPTPTTTGLSKTSASSLSLTSTMTSITSASTFTPASI
RTSKASASTSTSASIRTSIAFASTSTPTTSGPSTASVSTLNSTSIRTSTGSSSSLSATHT
SSSLTVSTGTHTTSNHTGTPVMEVKPSGSLKPWEIFLITLASVIVVMGLSAGLFIYVRRY
LSLRNAADGIFYNSHPDPGGSAMTPGSPTCSWRRPRTFNVVEMTRI
NT seq 4821 nt   +upstreamnt  +downstreamnt
atgcagaggagaagcagcctctggtgctggctgcttttgcagatcctgcttttaggaagt
ggttatgcccatatttcctccaccacaacttcaaatccttcatcagaaacgaagagcata
gccacagactatgaaaccaccccgaccaccactatatctagcactgcctcaggatctatg
cccaccctgaccaccaaggcatccagcattgcctcagactctaagcccaccctgaccacc
actgcatccagcactgcctcaggatctatgtccaccccgaccacccctgcatccagcact
gcctcaggctctacacccacaacgaccaccactgcatccagcactgcctcaggatctaca
cccaccccaaccacccctgcatccagcactgcctcaggatctacacctaccccgaccact
actgcatctagcaaagcctcaagatctgtgcccaccactgtatccagcactggctcaggc
tctacacccactccgaccaccactgcatccagcactgcctcaggatctacgcccaccctg
accaccactccatcaagcactgcctcaggatctacacctaccccgaccacccctgcatcc
agcactgcctcaggctcttcacccaccccaaccacccctgtatccagcactgcctcagga
tctacacccaccccgaccaccactgcatctagcaaggcctcaggatctgtgcccaccact
gtatccagcactggctcaggctctacacccactctgaccaccactgtatccagcactgtc
tcagactctacacccaccccgaccaccactgcatccagcactgcctcaggatcagcaccc
accccgaccaccactgcatctagcactgcctcaggatctacacccaccctaaccaccact
gcatccagcagtggctcaggctctacccccaccctgcccaccactgaatccagcactgcc
tcaggctctacacctacccggaccaccactacatccagcactgcctcaagatctacaccc
actcctaccaccactgcatctagcactgcctcaggatctacgcccaccccgaccaccact
gtatccagcactggatcaggctctacacctaccctgaccaccactgcatccaggagtggc
tcaggctctacccccaccctgaccaccactgaatccagcactgcctcaggctcctcaccc
accctgaccaccactgcatccagctctgcctcaggatctatgcccaccccgaccaccact
gcatccagcactgcctcaggctcctcacccaccctgaccaccactgcatccagctctgcc
tcaggatctatgcccaccctgaccaccactgcatccagctctgcctcaggctcctcaccc
accctgaccaccactgcatccagctctgcctcaggatctatgcccaccccgaccaccact
gtatccagcactggctcaggctctacccccaccctgaccaccactgaatccagcactgcc
tcaggctctacacctacctggaccaccactacatccagcactgcctcaagatctacaccc
acccctaccaccactgcatctagcactgcctcaggatctacgcccaccccgaccaccact
gtatccagcactggctcaggctctacacctaccctgaccaccactgcatccaggagtggc
tcaggctctacccccaccctgaccaccactgaatccagcactgcctcaggctctattcct
accctgaccaccgctgcatccagcactgcctcaggctctacacccacccctaccaccact
gcatctagcactgcctcaggatctatgcccaccccaaccactactgcatccagcactgga
tcaggctctacacccactctgaccaccactgcatctagcagtggctcaggctctaccccc
accctgaccaccactgaatccagcactgcctcaggctctatacctaccctgacctccgct
gcatccagctctgcctcaggatctatgcccaccccgaccaccactgtatccagcactggc
tcaggctctacacccaccctgaccaccactgcatccagctctgcctcaggatctatgccc
accccaaccactactgcatccagcactgcctcaggctcctcacccaccctgaccaccact
gcatccagctctgcctcaggatctgcgcccaacccgaccaccactgtatccagcactggc
tcaggctctacacccaccctgaccaccactgcatccagcagtggctcaggctctaccccc
accctgcccaccactgaatccagcactgcctcaggctctacacctacccggaccaccact
acatccagcactgcctcaagatctacacccactcctaccaccactgcatctagcactgcc
tcaggatctacgcccaccccgaccaccactgtatccagcactgcctcaggctctacacct
accctgaccaccactgcatccaggagtggctcaggctctacccccaccctgaccaccact
gaatccagcactgcctcaggctctacacccacccctaccaccactgcatctagcactgcc
tcaggatctgcgcccaacccgaccaccactgtatccagcactgcctcaggctctaccccc
accctgcccaccactgcatctagcagtggctcaggctctacccccaccctgaccaccact
gaatccagcactgcctcaggctcctcacccaccctgaccaccactgcatccagctctgcc
tcaggatctatgcccaccccgaccaccactgcatccagcactgcctcaggctcctcaccc
accctgaccaccactgcatccagctctgcctcaggatctatgcccaccctgaccaccact
gcatccagctctgcctcaggctcctcacccaccctgaccaccactgcatccagctctgcc
tcaggatctatgcccaccccgaccaccactgtatccagcactggctcaggctctaccccc
accctgaccaccactgaatccagcactgcctcaggctctacacctacctggaccaccact
acatccagcactgcctcaagatctacacccacccctaccaccactgcatctagcactgcc
tcaggatctacgcccaccccgaccaccactgtatccagcactggctcaggctctacacct
accctgaccaccactgcatccaggcgtggctcaggctctacccccaccctgaccaccact
gaatccagcactggctcaggctctacacccaccctgaccaccactgcatccagcagtggc
tcaggctctacccccaccctgcccaccactgaatccagcactgcctcaggctctacacct
acccggaccaccactacatccagcactgcctcaagatctacacccactcctaccaccact
gcatctagcactgcctcaggatctacgcccaccccgaccaccactgtatccagcactgcc
tcaggctctacacctaccctgaccaccactgcatccaggagtggctcaggctctaccccc
atcctgaccaccactgaatccagcactgcctcaggctctacacctaccctgaccaccgct
gcatccagctctgcctcaggatctacacccaccccgaccaccactgtatccagcactggc
tcaggctctacacccaccctgaccaccactgcatccagcagtggctcaggctctaccccc
accctgaccaccactgaatctagcactgcctcaggctctacacctacccagaccaccact
acatccagcactgcctcaagatctacacccactcctaccaccactgcatctagcactgcc
tcaggctctatacctaccccgaccacaactgcatcaagcattgcctcaggtactaccccc
accctgaccaccactgaatccagcactgcctcaggctcctcacccaccccgaccactgct
tcatccagcagtgcctcagactctaagcccacctcgaccaccactgcatccagcactgtc
tcagactctacacccaccccgaccaccaatgcatccagcagtgcctcaggctctacaccc
acccagaccaccactgcatccagaagtgcctcaggatctgtgcccaccctgaccaccatt
gcattcagcactgcctcaggctctacacctaccctgaccaccactgcatccaactctgcc
tcctcttcttcacccaccccgactaccactgggctcagcaagacctctgcatcttcactc
agcttgacctccactatgaccagcataacctctgcctctacattcaccccagcctccatt
aggaccagcaaagcttctgcttctacatccacctcagcctccattaggaccagcatagcc
tttgcatctacatctaccccgaccacctctggacctagcacagcctcagtctctacactc
aactcgacctccatcagaaccagcacaggttccagctctagcctgagtgccacccacact
tcctctagcctgacagtttccactggaacacacactacctccaaccacactgggactcca
gtgatggaagtgaagcccagtggatccctgaagccctgggaaatctttctcatcacccta
gcctctgttatcgtggtcatgggactctctgctgggctatttatttatgtgagaagatac
ctgtctctgagaaatgctgctgatggaatattctacaactcccatcctgatcctggagga
tctgctatgactccagggagccctacctgctcctggaggagaccaagaaccttcaatgtc
gtagagatgacaaggatataa

DBGET integrated database retrieval system