KEGG   Mus musculus (mouse): 67278
Entry
67278             CDS       T01002                                 

Symbol
Pagr1a, 2900092E17Rik, C77040, P, PA1, PAGR1
Name
(RefSeq) PAXIP1 associated glutamate rich protein 1A
  KO
K14973  PAXIP1-associated protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    67278 (Pagr1a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    MLL3/MLL4 complex
     67278 (Pagr1a)
SSDB
Motif
Pfam: PAXIP1_C
Other DBs
NCBI-GeneID: 67278
NCBI-ProteinID: NP_084516
MGI: 1914528
Ensembl: ENSMUSG00000107068
UniProt: Q99L02
Position
7; 7 F3
AA seq 253 aa
MSLALGHGTIAGSTAAPLSEEGEVTSGLQALAVEDTGGPSVSASKAEEEGKGSQEEAGRE
GSRPEEALEAPSAASDERAEGEAEDWCVPCSDEEVELPANGQSWMPPPSEIQRLYELLAT
QGTLELQAEILPRRPPTPEAQSEEERSDEEPEAKEEEEEKPHMPTEFDFDDEPMTPKDSL
IDRRRTPGSSARSQKREARLDKVLSDMKRHKKLEEQILRTGRDLFSLDSEGPSPTSPPLR
SSGNSLFPRQRKY
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtcccttgccctgggccatggaaccattgcaggcagcacagcagcgcctctgtctgaa
gaaggggaagtgacttccggcctccaagctctggcggtggaggacactggaggtccctct
gtctcggctagtaaggccgaggaagaggggaaaggcagtcaggaggaggccgggcgtgag
ggatccaggcctgaggaggcactagaagctcccagcgctgcgagcgacgagcgtgcggag
ggagaagccgaagactggtgcgtgccctgcagcgatgaggaggtggagctgccggccaat
gggcagtcctggatgcccccaccctccgagatccagcggctctatgaactgctggctacc
caaggtactctggagcttcaagcagagatcctaccccgccggccgcctaccccagaggcc
cagagtgaagaggagagatcagacgaggagccagaggccaaagaagaggaggaggaaaag
ccgcacatgcctacagaatttgactttgatgatgagccaatgacaccaaaggactcactg
attgacaggagacggacaccaggaagctcagcccggagccagaaacgggaggcgcgtctg
gataaggtcctctcagacatgaagcgccataagaaactagaggagcaaatcctccggacc
gggagagacctcttcagcttagactcagagggccccagccccaccagccctccactccga
tcctcaggaaacagtctctttcccagacagcggaagtactga

DBGET integrated database retrieval system