KEGG   Mus musculus (house mouse): 67288
Entry
67288             CDS       T01002                                 
Symbol
Srek1ip1, 3110031B13Rik, Sfrs12ip1, Srsf12ip1
Name
(RefSeq) splicing regulatory glutamine/lysine-rich protein 1interacting protein 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-CCHC_3 zf-CCHC DUF1501 CDC45
Other DBs
NCBI-GeneID: 67288
NCBI-ProteinID: NP_080351
MGI: 1914538
Ensembl: ENSMUSG00000021716
UniProt: Q4V9W2
Position
13:104953696..104975805
AA seq 153 aa
MAVPGCNKDNVRAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELN
KLQALQEKRINEEEEKKKEKSREKIKLKKRRKRSYSSATEEDSAKQKKQKYQKKEKKKEK
KNKSKKGKHHKKEKKKRKKEKRSSPYHSELTKK
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcagtcccaggttgcaacaaggacaatgtcagagcaggctgcagaaaatgtggctac
cctggtcatctgactttcgagtgccgcaattttctccgggtagatcccaaaagggacatt
gtgttggacgtcagcagcaccagtagtgaggacagtgatgaagaaaatgaggagctgaac
aagctgcaggctctgcaggagaaaagaataaatgaagaagaggaaaagaaaaaggaaaag
agcagggagaaaattaaattgaagaaaaggaggaaaaggtcttactccagtgccactgaa
gaggactccgcaaaacaaaagaaacagaagtatcagaaaaaagaaaagaaaaaggaaaaa
aagaacaagtcaaagaaaggaaagcatcacaaaaaggaaaaaaagaagagaaaaaaggaa
aagcgttcttccccttaccattctgaactcaccaaaaagtaa

DBGET integrated database retrieval system