KEGG   Mus musculus (mouse): 67290
Entry
67290             CDS       T01002                                 

Gene name
3110040N11Rik, AI851475
Definition
(RefSeq) RIKEN cDNA 3110040N11 gene
  KO
K09131  uncharacterized protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    67290 (3110040N11Rik)
SSDB
Motif
Pfam: DUF167 ThiP_synth
Other DBs
NCBI-GeneID: 67290
NCBI-ProteinID: NP_080353
MGI: 1914540
Ensembl: ENSMUSG00000025102
Vega: OTTMUSG00000023339
UniProt: Q9CRC3
Position
7; 7 D3
AA seq 126 aa
MPKKAGATSKGKNQTKEPETAPPAAGPVATDPKGFVTIAIHAKPGSRQNAVTDLSTEAVG
VAIAAPPSEGEANAELCRYLSKVLDLRKSDVVLDKGGKSREKVVKLLASTTPEEVLEKLK
TEAEKK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctaagaaagccggtgcgacaagcaagggtaaaaaccaaaccaaagaaccagagaca
gcacctcctgctgcagggcctgtagcaactgaccctaaaggttttgtcaccatagccatt
catgccaaacctggctccagacagaacgctgtgacagatctgagcactgaggccgttggt
gtggccattgcagcacctccgtccgagggagaggcaaatgcggagctgtgtcggtacctc
tccaaggtcttggacctcaggaagagtgacgtggttctggataagggtggtaaatctcgg
gaaaaggtggtgaagctcttggcctctacaactccagaggaggtcttggagaagctgaaa
acagaagctgagaagaaataa

DBGET integrated database retrieval system