KEGG   Mus musculus (house mouse): 67291
Entry
67291             CDS       T01002                                 
Symbol
Ccdc137, 3110023B02Rik
Name
(RefSeq) coiled-coil domain containing 137
Organism
mmu  Mus musculus (house mouse)
SSDB
Other DBs
NCBI-GeneID: 67291
NCBI-ProteinID: NP_690020
MGI: 1914541
Ensembl: ENSMUSG00000049957
UniProt: Q8R0K4
Position
11:120348944..120355184
AA seq 290 aa
MARPGNIALVTARSAGLRGSGQPQGRRQQQAQGQQRSASLPGQRSKEKKKVNCKPKNQDE
QEIPFRLREIMRSRQEMKKTLSNKKRKKEAQVAFKKTLEKEAKGEEPDIAVPKFKQRKGE
SDVAYVQRMEQEAQHVLFLSKNQAPRQPEVQAAPKKEKSERKKAFQKRRLEKAQRKREAR
AVDRLEQELLKDTVKFGEVVLQPPELTVQPRRSTSRDAPGKKSLMLKKMLLGPGGGSPAP
ATSLARQRILGEERERAVQAYRALKKLHRQEMTPAQPPGSSFQRQGHACL
NT seq 873 nt   +upstreamnt  +downstreamnt
atggcgaggcctgggaacatagcactggttactgcgcggtcggccggtcttagaggctcg
ggacagccgcaggggcggcggcagcagcaggctcaaggacagcagcgctcggcctcactg
cccggacagcgcagcaaagaaaagaagaaagtgaattgcaagcctaagaaccaggatgag
caagaaatcccttttcggctccgagaaattatgaggagccgacaggagatgaaaaagacg
ctaagtaacaagaagagaaaaaaggaggcccaggtggctttcaagaagacgttggaaaag
gaagcgaagggggaggagccagacatcgctgtccccaagttcaagcaaaggaagggggag
tctgatgtggcctacgtccagcgcatggagcaggaggcccagcacgtgctgtttcttagc
aagaaccaggcccctcggcagccagaggtgcaggcagctcccaagaaggagaagtctgag
cgcaagaaagcgttccagaagcgacgactggaaaaggcccagaggaaaagggaagcaaga
gccgtggacagattggagcaggagctactgaaagatactgtgaagtttggagaagttgtg
ttgcagcccccagagctgacagttcagcccaggaggagcacaagcagagatgctcctggc
aagaaatcactaatgctgaagaagatgctgttgggtcctggtggcgggtccccggctcca
gccacctcactggcccgccagcggatcctgggggaagagcgggaacgggctgtgcaggct
tacagagccctgaagaagctgcatagacaggaaatgacacctgcacagccaccaggcagc
tctttccagaggcagggccacgcttgtctgtga

DBGET integrated database retrieval system