KEGG   Mus musculus (house mouse): 67295
Entry
67295             CDS       T01002                                 
Symbol
Rab3c, 2700062I01Rik, 3110015B08Rik, 3110037E15Rik, AI850886
Name
(RefSeq) RAB3C, member RAS oncogene family
  KO
K07883  Ras-related protein Rab-3C
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67295 (Rab3c)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    67295 (Rab3c)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    67295 (Rab3c)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    67295 (Rab3c)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB GTP_EFTU MMR_HSR1 Gtr1_RagA Fin Septin AAA_16
Other DBs
NCBI-GeneID: 67295
NCBI-ProteinID: NP_076341
MGI: 1914545
Ensembl: ENSMUSG00000021700
UniProt: P62823 Q542T7
Position
13:complement(110190721..110417530)
AA seq 227 aa
MRHEAPMQMASAQDARFGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFV
STVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNA
VQDWSTQIKTYSWDNAQVILAGNKCDMEDERVVSTERGQRLGEQLGFEFFETSAKDNINV
KQTFERLVDIICDKMSESLETDPAITAAKQSTRLKETPPPPQPNCGC
NT seq 684 nt   +upstreamnt  +downstreamnt
atgagacacgaggcgcccatgcagatggcctctgcacaagatgccaggtttggtcagaaa
gactcttctgaccagaacttcgactacatgttcaagttgctgatcattggcaatagcagc
gtgggcaaaacatctttcctgttccgttatgccgacgattcctttacatctgcattcgtc
agcacggttggcatcgatttcaaagtaaaaactgtattcaaaaatgagaagagaatcaag
cttcagatttgggacacagcaggccaggaaagatacaggaccatcaccacagcctactat
cgaggggccatgggcttcattttaatgtatgacatcacaaatgaagaatccttcaacgct
gtacaagattggtcaactcagatcaaaacatactcttgggataatgcccaggttatcctg
gctggaaacaaatgtgacatggaagatgagcgggttgtctcaaccgagagaggccagcgc
ttaggagaacagctcgggtttgagttttttgaaaccagcgccaaggataacatcaacgtg
aagcaaaccttcgagcgcctcgtagatatcatttgtgacaaaatgtcagagagcttggag
accgacccagccatcacagcggcaaagcagagcacgaggctcaaggagacccctcctcca
ccacagcccaactgtggctgctaa

DBGET integrated database retrieval system