KEGG   Mus musculus (mouse): 67305Help
Entry
67305             CDS       T01002                                 

Gene name
Gpx7, 3110050F08Rik, AI327032, GPX6
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
mmu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    67305 (Gpx7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    67305 (Gpx7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    67305 (Gpx7)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     67305 (Gpx7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Acyl-CoA_dh_C
Motif
Other DBs
NCBI-GeneID: 67305
NCBI-ProteinID: NP_077160
MGI: 1914555
Ensembl: ENSMUSG00000028597
Vega: OTTMUSG00000008245
UniProt: Q99LJ6 Q3TNK3
Position
4; 4 C7
AA seq 186 aa AA seqDB search
MVAAVATAWLLLWAAACAQSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTD
QNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENFARRTYSVSFPMFSKIAVT
GTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKPRITEQVMKLIL
RKREDL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggttgcagctgtggcgacggcgtggctgctcctgtgggccgcggcctgcgcgcaatcc
gagcaggacttctacgacttcaaggcggtcaacatccggggcaagctggtgtcgctggag
aagtaccgtggctcggtttccctggtggtgaacgtagctagcgaatgtggcttcacagac
cagaactaccgagccttgcagcagctgcagcgggacctgggcccccatcattttaatgtg
cttgccttcccttgcaaccagtttggccaacaggaaccagacaccaacagggagattgag
aactttgcccgccgcacctacagtgtctcttttcccatgtttagcaagatcgcagtcact
ggcactggtgcccaccctgccttcaagtacctaacccagacttctgggaaggagcccacc
tggaacttctggaagtacctagtggacccagacggaaaggtggtgggagcatgggacccc
actgtgccagtggcggagatcaagccccgtattacagagcaggtgatgaaactcatcctt
cggaaacgagaagacttgtga

DBGET integrated database retrieval system