KEGG   Mus musculus (house mouse): 67305
Entry
67305             CDS       T01002                                 
Symbol
Gpx7, 3110050F08Rik, GPX6
Name
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu01100  Metabolic pathways
mmu04918  Thyroid hormone synthesis
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    67305 (Gpx7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    67305 (Gpx7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    67305 (Gpx7)
   05016 Huntington disease
    67305 (Gpx7)
   05022 Pathways of neurodegeneration - multiple diseases
    67305 (Gpx7)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     67305 (Gpx7)
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin Acyl-CoA_dh_C
Other DBs
NCBI-GeneID: 67305
NCBI-ProteinID: NP_077160
MGI: 1914555
Ensembl: ENSMUSG00000028597
UniProt: Q99LJ6 Q3TNK3
Position
4:complement(108257414..108263910)
AA seq 186 aa
MVAAVATAWLLLWAAACAQSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTD
QNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENFARRTYSVSFPMFSKIAVT
GTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKPRITEQVMKLIL
RKREDL
NT seq 561 nt   +upstreamnt  +downstreamnt
atggttgcagctgtggcgacggcgtggctgctcctgtgggccgcggcctgcgcgcaatcc
gagcaggacttctacgacttcaaggcggtcaacatccggggcaagctggtgtcgctggag
aagtaccgtggctcggtttccctggtggtgaacgtagctagcgaatgtggcttcacagac
cagaactaccgagccttgcagcagctgcagcgggacctgggcccccatcattttaatgtg
cttgccttcccttgcaaccagtttggccaacaggaaccagacaccaacagggagattgag
aactttgcccgccgcacctacagtgtctcttttcccatgtttagcaagatcgcagtcact
ggcactggtgcccaccctgccttcaagtacctaacccagacttctgggaaggagcccacc
tggaacttctggaagtacctagtggacccagacggaaaggtggtgggagcatgggacccc
actgtgccagtggcggagatcaagccccgtattacagagcaggtgatgaaactcatcctt
cggaaacgagaagacttgtga

DBGET integrated database retrieval system