KEGG   Mus musculus (mouse): 67305Help
Entry
67305             CDS       T01002                                 

Gene name
Gpx7, 3110050F08Rik, AI327032, GPX6
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00590  Arachidonic acid metabolism
mmu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    67305 (Gpx7)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    67305 (Gpx7)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    67305 (Gpx7)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     67305 (Gpx7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA SCO1-SenC Acyl-CoA_dh_C Redoxin
Motif
Other DBs
NCBI-GeneID: 67305
NCBI-ProteinID: NP_077160
MGI: 1914555
Ensembl: ENSMUSG00000028597
Vega: OTTMUSG00000008245
UniProt: Q99LJ6 Q3TNK3
Position
4; 4 C7
AA seq 186 aa AA seqDB search
MVAAVATAWLLLWAAACAQSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTD
QNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENFARRTYSVSFPMFSKIAVT
GTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKPRITEQVMKLIL
RKREDL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggttgcagctgtggcgacggcgtggctgctcctgtgggccgcggcctgcgcgcaatcc
gagcaggacttctacgacttcaaggcggtcaacatccggggcaagctggtgtcgctggag
aagtaccgtggctcggtttccctggtggtgaacgtagctagcgaatgtggcttcacagac
cagaactaccgagccttgcagcagctgcagcgggacctgggcccccatcattttaatgtg
cttgccttcccttgcaaccagtttggccaacaggaaccagacaccaacagggagattgag
aactttgcccgccgcacctacagtgtctcttttcccatgtttagcaagatcgcagtcact
ggcactggtgcccaccctgccttcaagtacctaacccagacttctgggaaggagcccacc
tggaacttctggaagtacctagtggacccagacggaaaggtggtgggagcatgggacccc
actgtgccagtggcggagatcaagccccgtattacagagcaggtgatgaaactcatcctt
cggaaacgagaagacttgtga

DBGET integrated database retrieval system