KEGG   Mus musculus (mouse): 67306
Entry
67306             CDS       T01002                                 

Symbol
Zc2hc1a, 3110050N22Rik, AI790358, AU023959, Fam164a
Name
(RefSeq) zinc finger, C2HC-type containing 1A
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-C2HC_2 DZR zf-RING_15 DUF2321
Other DBs
NCBI-GeneID: 67306
NCBI-ProteinID: NP_775273
MGI: 1914556
Ensembl: ENSMUSG00000043542
Vega: OTTMUSG00000051307
UniProt: Q8BJH1
Position
3:7568475..7618908
AA seq 324 aa
MDGLEENGSVVQVGDLLPCKICGRTFFPLALKKHGPICQKTATKKRKTFDSSRQRAEGTD
IPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYI
QCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDSKGKPASRPQYKPSPLKKSNPPG
IPSSGSSRLPQPSTTSKTIVGVPTGKASSVNSPLGNKPQTLSPSHRAIAAPQAGANTKAR
NTTPPSLARNSVAGVLTNKRKTLTENYAARPDGDYTSSVNGGNSKGIEGNSSGHLPKFCH
ECGTKYPVEWAKFCCECGIRRMIL
NT seq 975 nt   +upstreamnt  +downstreamnt
atggacggactggaagaaaatggaagtgttgtgcaagttggagacttgttgccctgcaag
atttgcggaaggaccttcttcccgttggctctgaaaaaacatggacctatttgccagaaa
actgccactaagaagcggaagacttttgattccagccggcagagagctgaagggactgat
attcccacggtcaaacctctcaaacccaggccagaaccaccaaagaagccatccaattgg
agacgaaagcacgaggagttcattgccaccatcagagcagcgaaaggcctggaccaggct
ctcaaggagggcggcaagctgcctcctcctcctccgccctcttacgacccagattacatc
cagtgtccgtattgccagaggagattcaatgaaaatgcagccgacagacatataaacttt
tgtaaagaacaggcagcacgtattagtaataagggcaaattttctactgattctaaagga
aagccagcttctcggccacagtataagccgtctccgcttaaaaaatcaaatcctcctgga
attccatcatcaggatcctcccgactgccacagccaagtactactagcaaaacaattgta
ggtgtgcccacgggtaaagcatcttcagttaacagtcctttgggaaacaaacctcagacc
ttatctccttctcatagagcgatagcagccccccaggcaggagctaacaccaaggctaga
aataccacacctcctagtttggcaagaaattctgtggcaggggtgcttaccaacaaaaga
aagactttgactgagaactatgcagccaggccagatggagactatacatcttcagttaat
ggtggaaacagtaaaggcatcgagggaaattcatctggacacttaccaaaattctgccat
gagtgtgggacaaagtaccctgttgagtgggcaaagttctgctgtgaatgtggcattcga
agaatgattctgtga

DBGET integrated database retrieval system