KEGG   Mus musculus (mouse): 67326Help
Entry
67326             CDS       T01002                                 

Gene name
1700037H04Rik
Definition
(RefSeq) RIKEN cDNA 1700037H04 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4517 TrpBP
Motif
Other DBs
NCBI-GeneID: 67326
NCBI-ProteinID: NP_080367
MGI: 1914576
Ensembl: ENSMUSG00000027327
Vega: OTTMUSG00000015728
UniProt: Q9D1K7
Position
2; 2 F1
AA seq 174 aa AA seqDB search
MAAANRGSKPRVRSIRFAAGHDAEGSQSHVHFDEKLHDSVVMVTQESDNSFLVKVGFLKI
LHRYEITFTLPPVRRLSKDIRETPVHSLHLKLLSVTPTSEGYSIKCEYSAHKEGVLKEEM
LLACEGDIGTCVRVTVQARVMDRHHGTPMLLDGVKCVGAELEYDSEQSDWLGFD
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagccaacagaggcagtaagcccagagtccgaagtatccgctttgcagcaggc
cacgatgcagaaggctcccagagccacgtccactttgatgaaaagctgcatgactcggtg
gtcatggttactcaggagagtgacaacagcttcttagtcaaggttggcttcctgaagatc
ctgcacaggtatgagattaccttcactctgcctccagtgcgcagactgagcaaggacatc
cgtgagacccctgtccacagcttgcacctcaagctgctcagcgtcacacccacctctgaa
ggttacagcatcaagtgtgagtactcggcacacaaagaaggtgttctcaaagaggagatg
ctcctggcctgcgagggtgacataggcacctgtgtgcgtgtgacggtgcaggcgcgggtc
atggaccggcaccacggtacacccatgctgctggatggtgtcaagtgtgtgggcgctgag
ctggagtatgactcggaacagagcgattggctcggcttcgactga

DBGET integrated database retrieval system