KEGG   Mus musculus (mouse): 67337Help
Entry
67337             CDS       T01002                                 

Gene name
Cstf1, 1700057K18Rik, AI788832
Definition
(RefSeq) cleavage stimulation factor, 3' pre-RNA, subunit 1
  KO
K14406  cleavage stimulation factor subunit 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    67337 (Cstf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    67337 (Cstf1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage stimulation factor (CSTF) complex
     67337 (Cstf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 CSTF1_dimer ANAPC4_WD40 Frtz Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 67337
NCBI-ProteinID: NP_077161
MGI: 1914587
Ensembl: ENSMUSG00000027498
Vega: OTTMUSG00000016157
UniProt: Q99LC2
Position
2 H3; 2 94.84 cM
AA seq 431 aa AA seqDB search
MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMEN
DDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDG
QLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLA
FHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPT
LRLYDINTFQCFVSCNPQDQHTDAICSVNYNPSANMYVTGSKDGCIKLWDGVSNRCITTF
EKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLSGRQVHRTQAV
FNHTEDYILLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFR
ARFWYRRSTTD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtacagaaccaaagtgggtttgaaggaccggcagcagctctacaagctgatcattagc
cagctgctctacgacggttacattagtatcgccaatggcctcatcaatgagatcaagccc
cagtcggtgtgcgccccctcggagcagctcctgcatctcatcaagctagggatggagaac
gatgacactgcggtccagtatgccattggtcgctctgacacggttgccccgggcacaggg
atcgacctggagtttgatgcagacgttcaaacaatgtcaccagaggcttccgagtatgaa
acctgttatgtcacttcccacaaaggcccgtgccgcgtggccacctacagcagagacggg
cagttgatagccacaggatctgctgatgcttccataaagatactggacacagaaagaatg
ttggccaaaagtgccatgccaattgaggtcatgatgaatgagactgcacaacagaacatg
gagaaccacccagtgatccgaactctttacgaccacgtggatgaagtcacgtgtcttgct
tttcacccaacagaacagatcctggcctcgggctcaagggattatactctgaaattgttc
gattattccaaaccgtctgcaaaaagagctttcaaatacattcaggaagccgaaatgttg
cgttccatctctttccacccttctggagacttcatcctggtgggaactcagcatcccacg
cttcgcctgtatgacatcaacaccttccagtgttttgtctcctgcaatccccaagaccag
cacaccgatgccatctgctccgttaactataatcctagtgccaacatgtacgtcactggc
agcaaggacggctgcatcaagctgtgggatggcgtctccaaccgctgcatcacaaccttt
gagaaggctcacgatggggcagaagtctgctctgccattttctccaagaattccaagtac
atcctctcaagtggaaaagactctgtagcgaaactctgggagatttccacagggcggacg
ctggtgaggtacacaggcgcaggtctgagcggacggcaagtgcaccggacacaggcagtg
ttcaaccacactgaggactatattttgctgccggacgaaaggaccatcagcctgtgctgc
tgggactccaggacagctgagcgcaggaacctgctgtccctgggccacaacaacatcgtg
cgctgcatagtgcactcccccaccaaccctggcttcatgacgtgcagcgatgacttccga
gctcggttctggtaccggaggtccaccactgactga

DBGET integrated database retrieval system