KEGG   Mus musculus (mouse): 67365Help
Entry
67365             CDS       T01002                                 

Gene name
Pudp, 1700121L12Rik, GS1, Hdhd1, Hdhd1a
Definition
(RefSeq) pseudouridine 5-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    67365 (Pudp)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     67365 (Pudp)
Protein phosphatases and associated proteins [BR:mmu01009]
 HAD phosphatases
  Other HAD phosphatases
   67365 (Pudp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 67365
NCBI-ProteinID: NP_080384
MGI: 1914615
Ensembl: ENSMUSG00000048875
UniProt: Q9D5U5 A0A0C3SFZ4
Position
18; 18 D1
AA seq 234 aa AA seqDB search
MAAAVPVPQFRPVTHLIFDLDGLILNTEDLYTDVFEEICNRYGKKYNWDVKSLVMGKKAL
ETAQTIVEFLNLPISKEELLKESQEKLQMVLHTAGFMPGAEELIHHLKKHRLPFALATSS
ETVTFQTKTSRHTGFFGLFHHIVLGDDPEVKNGKPGMDIFLTCAKRFSPPPDPKDCLVFE
DSPNGVEAAIHCGMQVVMVPHENLSADLTRKATLVLSSLHDFKPELFGLPAFTE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagttcctgtgccccaatttcgaccagttacacacctgatatttgacctg
gacggacttattctgaatactgaagatttatataccgatgtgtttgaagaaatatgcaat
cgctatgggaagaaatacaactgggatgttaagtccctggtcatggggaagaaggctcta
gaaaccgcacagaccatagtagagttcctcaatttacccatatccaaagaagaactattg
aaagaaagtcaggagaagctgcagatggtgttgcacacagctggattcatgccaggagct
gaggaattgatccaccacctgaagaaacaccgcttaccctttgccctggccaccagctcc
gagaccgttaccttccaaacaaagaccagtagacacacaggattctttggtctatttcac
cacatcgttctgggggatgatcctgaagtaaagaatggcaagccaggcatggacatattt
ctaacctgtgccaagaggttctctcctccccctgatccaaaagactgcctcgtctttgaa
gattctccaaatggagtggaggcagccatccactgtgggatgcaggtcgtcatggtacct
catgaaaacctgagcgcagacctaacacgaaaagccaccctggtgctgagttccctccac
gacttcaagcctgaactgtttggtctacctgcctttacggaataa

DBGET integrated database retrieval system