KEGG   Mus musculus (mouse): 67369
Entry
67369             CDS       T01002                                 

Gene name
Qpctl, 1810019P04Rik, BB101812, gQC
Definition
(RefSeq) glutaminyl-peptide cyclotransferase-like
  KO
K00683  glutaminyl-peptide cyclotransferase [EC:2.3.2.5]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    67369 (Qpctl)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.5  glutaminyl-peptide cyclotransferase
     67369 (Qpctl)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   67369 (Qpctl)
Motif
Pfam: Peptidase_M28
Other DBs
NCBI-GeneID: 67369
NCBI-ProteinID: NP_080387
MGI: 1914619
Ensembl: ENSMUSG00000030407
Vega: OTTMUSG00000058595
UniProt: Q8BH73
Position
7; 7 A3
AA seq 383 aa
MSPGSRGRPRQRLEDRGLMKPPSLSKRRLLPRVQFLPLLLLALAMGLAFYIVWNSWHPGV
EEMSRSRDLRVPLIGSLSEAKLRLVVGQLDPQRLWGTFLRPLLIVRPPGSSGNLQVRKFL
EATLQSLSAGWHVELDPFTASTPLGPLDFGNVVATLDPGAARHLTLACHYDSKFFPPGLP
PFVGATDSAVPCALLLELVQALDAMLSRIKQQAAPVTLQLLFLDGEEALKEWGPKDSLYG
SRHLAQIMESIPHSPGPTRIQAIELFVLLDLLGASSPIFFSHFPRTARWFQRLRSIEKRL
HRLNLLQSHPQEVMYFQPGEPPGPVEDDHIPFLRRGVPVLHLIATPFPAVWHTPADTEAN
LHPPTVHNLSRILAVFLAEYLGL
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgagtcccgggagccgcgggcggccccggcagcggctcgaggatcgtggcctcatgaaa
ccaccctcactttccaagcgccgtcttctgccgcgagtgcagttcctgcccctgctgctg
ctggcgctggctatgggcttggctttctatatcgtctggaacagctggcaccctggggtt
gaggagatgtcacggagccgggatctgcgggtcccgctgatcggaagcctttcagaagcc
aagctgcggctggtggtagggcagctggatccgcagcgtctctggggaactttcctgcgt
cccttattgattgtgcgacccccgggtagttctggcaatctccaagtgagaaagttcctg
gaggctacgttgcagtccctgtcggcaggctggcatgttgaactggacccattcacggcc
tcaacccccttggggccactggacttcgggaacgtggtggccacacttgacccaggagct
gcccgtcacctcaccctcgcctgccattatgactctaagttcttccctccggggttgccc
ccctttgtgggggccacagattcagctgtgccctgtgccctgcttctggagttggtccag
gcccttgatgccatgctgagcagaatcaagcagcaggcagcaccggtgaccctgcagctg
cttttcttggatggggaggaggcactgaaggagtggggaccaaaggactccctctatggc
tcccggcacctagctcagatcatggagtctataccacacagccctggccccaccaggatc
caggctattgagctctttgtcctcctcgaccttctgggagcatccagtccgatcttcttc
agtcacttccctcgcacagcccgctggttccagcgactgaggagcattgagaagcgcctt
caccggctgaacctactgcagtctcacccccaggaagtgatgtacttccaacccggggag
ccccccggccctgtggaagatgaccacatccccttccttcgcagaggggtcccggtgctc
cacctcattgccacgcccttccctgctgtgtggcacacacctgctgacaccgaggccaac
ctccacccacccactgtgcataacctgagccgcatccttgctgtgttcctggccgagtac
ctgggactctag

DBGET integrated database retrieval system