KEGG   Mus musculus (mouse): 67374
Entry
67374             CDS       T01002                                 

Gene name
Jam2, 1110002N23Rik, 2410030G21Rik, 2410167M24Rik, JAM-, JAM-2, JAM-B, Jcam, Jcam2, VE-J, VE-JAM
Definition
(RefSeq) junction adhesion molecule 2
  KO
K06735  junctional adhesion molecule 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    67374 (Jam2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    67374 (Jam2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    67374 (Jam2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    67374 (Jam2)
CD molecules [BR:mmu04090]
 Proteins
  67374 (Jam2)
SSDB
Motif
Pfam: Ig_3 ig I-set Ig_2 V-set Izumo-Ig Ig_6 C2-set_2
Other DBs
NCBI-GeneID: 67374
NCBI-ProteinID: NP_076333
MGI: 1933820
Ensembl: ENSMUSG00000053062
Vega: OTTMUSG00000025168
UniProt: Q9JI59
Position
16; 16 C3.3
AA seq 298 aa
MARSPQGLLMLLLLHYLIVALDYHKANGFSASKDHRQEVTVIEFQEAILACKTPKKTTSS
RLEWKKVGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRSDAGEYRCEVSAPTEQGQ
NLQEDKVMLEVLVAPAVPACEVPTSVMTGSVVELRCQDKEGNPAPEYIWFKDGTSLLGNP
KGGTHNNSSYTMNTKSGILQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLNISGI
IATVVVVAFVISVCGLGTCYAQRKGYFSKETSFQKGSPASKVTTMSENDFKHTKSFII
NT seq 897 nt   +upstreamnt  +downstreamnt
atggcgaggagcccccaaggcctcctgatgctgctgctgctacactacttgatcgtcgcc
ctggactatcataaggcaaatgggttttctgcatcaaaagaccaccgtcaagaagtcaca
gtaatagagttccaagaggctattttggcttgtaaaaccccaaagaagactacctcctcc
agactggagtggaagaaggtgggacagggggtctccttggtctactaccaacaggctctc
caaggtgactttaaagaccgtgctgagatgatagatttcaatatacgaatcaaaaatgtt
acaagaagtgatgctggagagtatcgctgtgaagtcagcgctccgactgagcaaggccag
aacctgcaggaagataaagtcatgctagaagtactagtggctcctgctgttcctgcctgt
gaagtgcccacttctgttatgactggaagtgtggtggagctacgatgccaggataaagaa
ggaaacccagctccggagtacatctggtttaaagatggcacaagtttgctagggaatcca
aaaggcggcacacacaacaacagctcgtacacaatgaacacgaagtctggaattctgcaa
ttcaacatgatttccaagatggacagtggagagtattactgcgaagcccggaactctgtc
ggacaccgcaggtgccctgggaagcgaatgcaagtagatgttctcaacataagcggcatc
atagcaacggttgtggtggtggccttcgtgatttctgtatgtggccttggcacatgctat
gctcagaggaaaggctacttttcaaaagaaacttccttccagaagggcagtcctgcatct
aaagtcactacgatgagcgaaaatgatttcaagcacacaaaatcctttataatttaa

DBGET integrated database retrieval system