KEGG   Mus musculus (house mouse): 67378
Entry
67378             CDS       T01002                                 
Symbol
Bbs2, 2410125H22Rik
Name
(RefSeq) Bardet-Biedl syndrome 2 (human)
  KO
K16747  Bardet-Biedl syndrome 2 protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    67378 (Bbs2)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  BBSome
   67378 (Bbs2)
SSDB
Motif
Pfam: BBS2_C BBS2_Mid BBS2_N FG-GAP FG-GAP_3 Itfg2 Lipin_N
Other DBs
NCBI-GeneID: 67378
NCBI-ProteinID: NP_080392
MGI: 2135267
Ensembl: ENSMUSG00000031755
UniProt: Q9CWF6
Position
8:complement(94794580..94825997)
AA seq 721 aa
MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQAGKVFIHNPHTRSQHFSASRVFQS
PLESDVSLLNINQTVSCLGSGVLNPELGYDTLLVGTQTSLLAYDIYNNSDLFYREVSDGA
NAIVLGTLGDIAPPLAIIGGNCALQGFDHEGNDLFWTVTGDNVHSLALCDFDGDGKTELL
VGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTARYWRIKS
KNHAMSIHAFDINSDGVCELITGWSNGKVDARSDRTGEVIFKDNFSSAVAGVVEGDYRMD
GHVQLICCSVDGEIRGYLPGTAEMKGNLLDTSVEQDLIRELSQKKQNLLLELRNYEESTK
AELSSPLNEADGQKGIIPANTRLHTALSVNMGNDLQDAHAELGISTSNDTIIRAVLIFAE
GIFVGESHVVHPSIHNLSSSLRVPITPPKDVPVDLHLKTFVGYRSSTQFHVFELTRQLPR
FTMYALTSPDAASEPVSYVNFSVAERTQRMVTWLNQNFLLPEDSNVQNSPFHVCFTSLRN
GGQLYIKMKQSGEITVNTDDIDLAGDIIQSIASFFAIEDLQVEADFPVYFEELRKVLVKV
DEYHSVHQKLSADMADNSNLIRSLLVRAEDARLMRDMKTMKSRYMELYDLNKDLLNGYKI
RCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVISACRDAIRSNNINTLFRIMRVGTAP
S
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgctgctgcctgtgttcactctgaaactgcgccacaaaatcagcccccgcatggtggcc
atagggcgctacgacgggactcacccgtgcttggctgccgccacccaagcgggcaaggtt
ttcattcataaccctcacacgcggagccagcatttcagtgcttccagagtgttccagagc
cctctggagtctgatgtctctctgctcaacattaaccagacggtcagctgcctgggttcg
ggagtcttgaaccctgagcttggctatgatactcttttagtggggacacagaccagtctt
ttggcttacgacatctacaataattcagatttgttctacagagaggtctcagatggggca
aatgccattgtgctggggaccctgggagacattgccccacctcttgcaatcatcggtgga
aactgtgctctgcagggtttcgatcacgaaggaaatgatctcttttggacggttactgga
gacaatgtgcattccttggctctgtgtgactttgacggtgatgggaagacagagcttctt
gttggatctgaagattttgacattcgagtttttaaagaagatgagattgtggcagaaatg
acagagacagagatagtcacctctctgtgtcctatgtatggcagtcggtttggttacgcc
ctttctaatggcacagttggagtttatgacaaaacagcccggtactggagaattaaatcc
aaaaaccatgccatgagcatccatgcttttgacattaattctgatggagtgtgtgaactg
ataaccgggtggtctaatgggaaggttgatgctcgcagtgaccggactggagaggtcata
tttaaagacaacttctcttctgctgttgctggtgtggtagagggagattaccggatggat
ggccacgtacagttaatctgctgctcagtggatggggaaatccgaggctacctgccaggc
acagctgagatgaaggggaacctcctggacacaagtgtggagcaggacctgatccgagag
ctgagtcagaaaaagcagaacctgttgctagaacttcgcaactatgaggagagcaccaag
gcagaactgagcagtcccctgaacgaggccgatgggcagaaaggcataatcccagccaat
accaggctccacacagcgctctcagtcaatatggggaatgacttacaagatgcgcatgcg
gaattaggcatttccacttccaatgatactatcatccgagcagtactaatttttgcagag
ggaatttttgtgggtgaaagccatgtggtccaccccagcattcacaacctttccagctcc
ctccgggtaccaattacacctcccaaagatgtccctgtggatctgcacctgaaaaccttc
gtgggttacagaagcagcacccagttccatgtgtttgaactgacaagacagctgccccga
ttcaccatgtatgcattgacaagcccagatgcagctagcgagcctgtcagctacgtgaac
ttcagtgttgccgagcgcacacagaggatggtcacgtggctcaaccagaactttctgttg
ccagaagacagtaacgttcagaattccccgtttcacgtctgtttcacatcgttacgcaat
ggtggccagctctacataaaaatgaaacaaagtggtgagatcactgtgaatactgacgat
attgatctagctggtgacatcatccagtcgatcgcgtccttttttgctattgaagacctt
caggtagaagcagatttccctgtgtacttcgaggaactacggaaagtgctggtgaaggtg
gatgagtatcattcagtgcatcaaaagctcagcgccgacatggctgataattctaacctc
atccgaagtttgctggtcagagcggaggatgctcggctgatgagggacatgaaaacaatg
aagagtcgttacatggagctctatgaccttaataaagatttgctgaatggatacaagatt
cgctgtaacaaccacacagaactgctaggaaacctgaaggcggtgaaccaagcaatccaa
agagcaggccgtctgcgcgttggaaagccaaagaaccaggtgatcagtgcttgtcgggat
gcgattcgaagcaacaacatcaacaccctcttcagaatcatgcgagtgggcactgctcct
tcatag

DBGET integrated database retrieval system