KEGG   Mus musculus (mouse): 67382Help
Entry
67382             CDS       T01002                                 

Gene name
Brd3, 2410084F24Rik, AW060456, Fsrg2, ORFX, RINGL3
Definition
(RefSeq) bromodomain containing 3
  KO
K11721  bromodomain-containing protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    67382 (Brd3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    67382 (Brd3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  BRD family [OT]
   67382 (Brd3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    67382 (Brd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain BET TAF4
Motif
Other DBs
NCBI-GeneID: 67382
NCBI-ProteinID: NP_001107045
MGI: 1914632
Ensembl: ENSMUSG00000026918
Vega: OTTMUSG00000012035
UniProt: Q8K2F0 Q3TUI3
Structure
PDB: 

Position
2; 2 A3
AA seq 726 aa AA seqDB search
MSTTAAAPTGIPAVPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQ
PVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDD
IVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKPAAGAQNAGSQQVAAVSSVSPAT
PFQNIPPTVSQTPVIAATPVPTITANVTSVPVPPPAAPPPPATPIVPVVPPTPPVVKKKG
VKRKADTTTPTTSAITASRSESPPPLSEPKQAKVVARRESGGRPIKPPKKDLEDGEVPQH
AGKKGKLSEHLRHCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTV
KRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPME
APALPAPTAPIVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALS
QAPVNKPKKKKEKKEKEKKKKDKDKDKEKEKHKAKSEEEKKAKAAPAAKQAQQKKAPTKK
ANSTTTASRQLKKGGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHII
QSREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKKQRKPLSTSGKKQAAKSKEE
LAQEKKKELEKRLQDVSGQLNSKKPTKKEKSGSAPSGGPSRLSSSSSSESASSSSSGSSS
DSSDSE
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtccactacagcggctgcccccacggggatcccggcagtcccgggccccgtgaaccct
cccccacctgaggtctccaaccccagcaagcccgggcgaaagactaaccaactgcagtac
atgcagaatgtagtggtgaagacactctggaaacatcagtttgcctggcctttctaccag
cctgtggatgcaatcaagctgaacctgcctgattatcataaaataataaaaaacccaatg
gacatggggactatcaagaagagactagaaaataattattattggagtgccagtgagtgt
atgcaggacttcaacaccatgtttacaaactgttatatttataataagcccacagatgat
atagtgctaatggcccaggccttagagaaaatctttctgcagaaagtggcccagatgcct
caggaggaagttgaactattgccccctgctccaaagggcaaaggccggaagccagctgca
ggagcccaaaatgcaggttcccaacaagtggcagctgtgtcttcggtctccccagcaacc
cccttccagaacataccccccaccgtgtcccagacacccgtcattgccgctacccctgta
ccaaccatcactgcaaacgtcacgtcagttccagtccccccacccgctgcaccgcctcct
cctgcgacacccatcgtccctgtggtccctcccacaccgcctgtagtcaagaaaaagggc
gtgaagcggaaagcagacacaaccacacccacaacatctgccatcactgccagccggagt
gagtctcccccaccactttcagagcccaagcaagccaaggtagtggcccgaagggagagc
gggggccgccccatcaaacctcccaagaaggacctggaagatggtgaggtcccacagcac
gcgggtaaaaagggaaaactgtccgagcacctgcggcactgtgacagcatcctccgggag
atgctgtccaagaagcatgctgcctatgcgtggcccttttacaagccagtggacgcggag
gcgctggagctgcatgactaccatgacatcatcaagcaccccatggacctcagcacggtc
aaaaggaagatggatagccgagagtacccagatgcacagggctttgctgctgatatccgg
ttaatgttctcgaattgttataagtacaaccctccagaccacgaagtggtggccatggcc
aggaagctccaggatgtgtttgagatgaggtttgccaagatgcccgatgagcccatggag
gcgcctgcgctgcccgctcccacggcccccatcgtgagcaagggggctgagagcagccgc
agtagtgaggagagctcttcagattcaggcagctcagactcagaagaggagcgagccact
cggctggctgagctgcaggagcagctgaaggccgtgcacgaacagctggctgccttgtct
caggccccagtgaacaaaccaaagaagaagaaagagaagaaggaaaaggaaaagaagaag
aaagacaaggacaaagacaaagagaaggagaagcacaaggccaagtctgaggaggagaag
aaggccaaggcagccccagcagccaagcaggcccagcagaaaaaggctcccaccaagaag
gccaacagcacaaccacagccagcagacagctcaagaagggcggcaagcaggcatctgcg
tcctatgactcagaggaagaggaggagggcctgcccatgagctatgatgaaaagcgacaa
cttagccttgacatcaaccggctgcccggcgagaagctagggcgtgtggtgcacatcatt
cagtctcgggagccctcgcttcgggactcaaacccagacgagattgagattgactttgag
accctgaagccaaccacgctgcgggaactggagagatatgtcaagtcttgtttacaaaaa
aagcagaggaaaccattgtcaacaagcgggaagaagcaggcagccaaatcgaaagaggag
ctagctcaggagaagaaaaaggagctggagaagcggctgcaggatgtcagtggacaactg
aacagcaaaaaacccactaagaaagagaagtccggctcagctccctcaggaggcccatca
aggctcagcagtagcagctcctctgagtctgcgagcagtagctccagtggatcgagctcc
gacagcagtgactcagagtga

DBGET integrated database retrieval system