KEGG   Mus musculus (mouse): 67387
Entry
67387             CDS       T01002                                 

Gene name
Unc50, 1110002A21Rik, GMH1, UNCL, URP
Definition
(RefSeq) unc-50 homolog
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: UNC-50
Other DBs
NCBI-GeneID: 67387
NCBI-ProteinID: NP_080399
MGI: 1914637
Ensembl: ENSMUSG00000026111
Vega: OTTMUSG00000021774
UniProt: Q9CQ61
Position
1; 1 B
AA seq 259 aa
MLPSTSLSSSMHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP
QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI
DCVGVGLLISTLMWFVSNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFIN
HVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLMVLYGLSL
ALGWNFTHTLCSFYKYRVK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgctaccaagtacttccttgagttcttcgatgcacgggaatggagtattaaattccagg
gatgcagcaaggcacacggctggagcaaaacgctacaagtacctcagaaggctctttcga
tttcggcagatggactttgagtttgctgcatggcagatgctctacctgtttacctctcct
cagagggtttatagaaactttcactaccggaagcaaacaaaggaccagtgggccagagat
gaccctgccttcttagtcctcttaagtatctggctctgtgtgtccaccataggattcggc
tttgtgctggacatgggattttttgagacaataaagctgctgctgtgggttgtgtttata
gattgtgtgggtgttggccttctgatctcaacgttaatgtggttcgtctccaacaagtac
ctggtgaaacgccagagcagggactatgacgtggagtggggctatgcctttgatgtgcat
ctgaacgccttctatccgctcctcgtcattctgcattttatccagctcttcttcatcaac
catgttattctcacagatacatttattggatatttagttggaaataccttatggttgatt
gctgttggctattatatctatgtgaccttcctgggatacagtgcactgccatttttgaaa
aatacagtgatcctgctctatccattcgcacctctcatggtgctgtacgggctgtcgctg
gcactgggatggaactttacccacacattgtgttccttctacaagtacagagtgaagtga

DBGET integrated database retrieval system