KEGG   Mus musculus (mouse): 67393
Entry
67393             CDS       T01002                                 

Symbol
Cxxc5, 4930415K17Rik
Name
(RefSeq) CXXC finger 5
  KO
K22760  CXXC-type zinc finger protein 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    67393 (Cxxc5)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   CXXC CpG-binding proteins
    67393 (Cxxc5)
SSDB
Motif
Pfam: zf-CXXC
Other DBs
NCBI-GeneID: 67393
NCBI-ProteinID: NP_598448
MGI: 1914643
Ensembl: ENSMUSG00000046668
UniProt: Q91WA4
Position
18:35962432..35994746
AA seq 317 aa
MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAPTSVADDAPPPERRNK
SGIISEPLNKSLRRSRPLSHYSSFGSSGGGGSMMGVESADKAAAAAASLLANGHDLAAAM
AVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQSTEMLKRVVQEHLPLMSE
AGAGLPDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTPAGVFLAESALHMAGLAEYPM
QGELASAISSGKKKRKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRKCEELKKKPSA
ALEKVMLPSGAAFRWFQ
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtcgagcctcggcggtggctcccaggacgccggtggcagtagcagcagcagtaacacc
aatagcagcagtggcagtggccaaaaggcaggaggaacagacaaaagtaccgcggtggcc
gccaccacggcgccgacctccgtggcagacgatgccccaccccctgagcgtcggaacaag
agcggtatcatcagtgaacccctcaacaagagcctgcggcgctcccgaccactctctcac
tactcttcctttggtagcagtggtggcggcggaagcatgatgggggtggagtctgctgac
aaggcagcggcagccgcagcctccctattggccaatggtcatgacctggctgcggccatg
gcagtggacaaaagcaaccctacctcaaagcacaaaagtggtgctgtggccagcctgctg
agcaaggcagagagggccacagagctggcagctgagggacagctgacgctgcagcagttt
gcacagtccacagagatgctaaagcgcgtggtgcaggaacacctgccactgatgagtgag
gccggtgccggcctgcctgacatggaggctgtggccggcgccgaagccctcaatggccag
tccgacttcccctatctgggcgctttccccatcaatccaggcctcttcatcatgacccca
gctggcgtgttcctggctgagagtgcactgcacatggctggcctggccgagtaccccatg
cagggagagctggcttccgccatcagctcaggcaagaagaagcggaaacgctgcggcatg
tgtgcgccctgccggcggcgcatcaactgtgagcagtgcagcagttgtaggaaccgaaag
actggccatcagatttgcaaattcagaaagtgtgaagaactcaaaaagaagccttccgct
gctctggagaaggtgatgcttccgtcgggagccgccttccggtggtttcagtga

DBGET integrated database retrieval system