KEGG   Mus musculus (house mouse): 67417
Entry
67417             CDS       T01002                                 
Symbol
Ears2, 3230401I01Rik, mKIAA1970
Name
(RefSeq) glutamyl-tRNA synthetase 2, mitochondrial
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00860  Porphyrin metabolism
mmu00970  Aminoacyl-tRNA biosynthesis
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    67417 (Ears2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    67417 (Ears2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    67417 (Ears2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    67417 (Ears2)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:mmu02048]
    67417 (Ears2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     67417 (Ears2)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   67417 (Ears2)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    67417 (Ears2)
 Prokaryotic type
   Other AARSs
    67417 (Ears2)
Prokaryotic defense system [BR:mmu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    67417 (Ears2)
SSDB
Motif
Pfam: tRNA-synt_1c Anticodon_2 TetR_C_7
Other DBs
NCBI-GeneID: 67417
NCBI-ProteinID: NP_080416
MGI: 1914667
Ensembl: ENSMUSG00000030871
UniProt: Q9CXJ1
Position
7:complement(121633385..121666436)
AA seq 523 aa
MAAPLKRLLLAEPHVVALGHRVGRREASLGPDPGAPVRVRFAPSPTGFLHLGGLRTALYN
YIFAKKHQGSFILRLEDTDQSRLVPGAAESIEDMLEWAGIPPDESPRRGGPAGPYCQSQR
LALYAQATEALLRSGAAYPCFCLPQRLELLKKEALRSRQTPRYDNRCRNLSQAQVAQKLA
VDPKPAIRFRLEEAVPAFQDLVYGWTQHEVASVEGDPVILKSDGFPTYHLACVVDDHHMS
ISHVLRGSEWLVSTSKHLLLYQALGWQPPRFAHLPLLLNRDGSKLSKRQGDIFLEHFAAT
GFLPEALLDIITNCGSGFAENQMGRTLPELITQFDLTRITCHSALLDLEKLPEFNRLHLR
RLVSSETQRPQLVEKLQGLVKEAFGSELQNKDVLDPAYMERILLLRQGHISRLQDLVSPV
YSYLWTRPAVHRSELGASSENVDVIAKRLLGLLERPGLSLTQDVLNRELKKLSEGLEGAK
HSSVMKLLRMALSGQLQGPPVAEMMVSLGPKEVRERIQKVLSS
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggcggcgcccctcaagaggcttctgctggccgagccgcacgtggtggccctcgggcac
cgcgtggggcggcgcgaggccagtctgggcccagatcccggggccccggtgcgagtgcgc
ttcgctcccagccccacaggcttcctgcacctgggtggcctccgtactgccctctacaac
tacatctttgccaagaagcaccaagggagcttcattctgaggctggaggacaccgatcag
agccgcttggtgccaggggcagcagaaagcattgaggacatgctggagtgggcaggcatc
ccacctgatgagagtccccgccggggtggtcctgcagggccctactgtcagtcccagcgg
ctggctctgtatgcccaagccacggaagccttgctgagatctggagctgcctatccctgt
ttctgtttgccacagcggctggagcttctgaagaaggaagcactgaggagccgacagaca
ccccggtatgacaatcggtgccggaacctgagccaggcacaggtggcccagaagctggcc
gtagaccccaagcctgctatccgcttccgtctagaggaggcagtaccagccttccaggac
ctggtatatggctggactcagcatgaagtggccagtgtggagggggacccagttatcctg
aaaagtgacggctttcccacctaccacctagcctgtgtggtagatgaccaccacatgagc
atcagccatgtgctgcggggctccgagtggctagtctccacctccaagcacctgctcctc
taccaggccctgggctggcagccacctcgatttgctcatctgcccctgctcctcaacagg
gatggtagcaagctgtctaagaggcaaggggacattttcctggaacattttgctgccacc
ggttttctgccagaagccttgcttgacatcatcaccaactgtggctcggggtttgcagag
aaccaaatgggcaggaccctgccggagctgattacacagtttgacctgacgcggatcacc
tgccactcagccctgctggacctagagaagctcccagaatttaacaggctgcacctccgc
cggctggtgagcagtgagacccagaggccccagttggtggagaaattgcagggcctggtg
aaggaggcattcgggagtgaactgcaaaacaaggatgttctggaccctgcatatatggag
aggatcctcctgctgagacagggtcacatcagccgcctgcaggatctggtctccccagtg
tactcctacttatggacccgccctgctgtccatcgatcagaactgggtgccagctcggaa
aacgtggatgtgattgccaagcgcttgctggggcttttagaaagacctggcttaagccta
actcaggatgtgctgaacagagagctgaagaagctgtcagaaggtctggaaggcgccaag
catagcagtgtgatgaagctcctccggatggccctcagtggacagctgcaaggaccccct
gtggctgagatgatggtgtccttgggcccaaaggaagtacgggaacgaatccagaaggtg
ctttctagctag

DBGET integrated database retrieval system