KEGG   Mus musculus (house mouse): 67419
Entry
67419             CDS       T01002                                 
Symbol
Armh4, 3632451O06Rik, AU067705
Name
(RefSeq) armadillo-like helical domain containing 4
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: ARMH4 Sigma70_ner Csc2 Nop14
Other DBs
NCBI-GeneID: 67419
NCBI-ProteinID: NP_080418
MGI: 1914669
Ensembl: ENSMUSG00000036242
UniProt: Q8BT18
Position
14:complement(49919017..50020843)
AA seq 775 aa
MLQDSITGIVNSFNLFFPSTMSRPTLMPTCVAFCSILFLTLATGCQAFPKVERRETAQEY
AEKEQSQKMNTDDQENISFAPKYMLQQMSSEAPMVLSEGPSEIPLIKVFSVNKESHLPGA
GLLHPTSPGVYSSSEPVVSASEQEPGPSLLERMSSEHSLSKVMLTVAVSSPASLNPDQEG
PYNSLSTQPIVAAVTDVTHGSLDYLDNQLFAAKSQEAVSLGNSPSSSINTKEPEIIKADA
AMGTTVVPGVDSTGDMEPDRERPSEMAADDGQSTTTKYLVTIPNNFLTTEPTAGSILGDA
KVTVSVSTAGPVSSIFNEEWDDTKFESISRGRPPEPGDNAETQMRTKPPHGTYESFEGTE
ESPSSTAVLKVAPGHLGGEPALGTALVTALGDERSPVLTHQISFTPMSLAEDPEVSTMKL
FPSAGGFRASTQGDRTQLSSETAFSTSQYESVPQQEAGNVLKDITQERKMATQAMNTTSP
VVTQEHMATIEVPRGSGEPEEGMPSLSPVPAEVADAELSRRGESLATPASTTVVPLSLKL
TSSMEDLMDTITGPSEEFIPVLGSPMAPPAMTVEAPTISSALPSEGRTSPSISRPNTAAS
YGLEQLESEEVEDDEDEEDEEDEEEEEEDEEDEEDEEDKETDSLYKDFDGDTEPPGFTLP
GITSQEPDIRSGSMDLLEVATYQVPETIEWEQQNQGLVRSWMEKLKDKAGYMSGMLVPVG
VGIAGALFILGALYSIKVMNRRRRNGFKRHKRKQREFNSMQDRVMLLADSSEDEF
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgctccaggactcaattactggaattgtcaactccttcaacctgtttttcccatccact
atgagcagaccaactctgatgcccacctgtgtggctttctgtagcattctcttcctcacc
ttggctacaggatgtcaagctttcccaaaggtggaaaggagggagacagcacaagaatat
gcagagaaagagcagtcccagaagatgaacactgatgaccaagaaaacatctcctttgct
ccaaagtacatgctgcagcagatgtcctctgaagctccaatggtactatctgaaggacct
tcagagataccattaattaaagtattctcagtcaacaaagagagccatcttccaggagct
gggcttctgcatcctaccagccctggtgtttactcttccagtgagcctgtggtctcagcc
agtgaacaagagcctggccccagcctgcttgaaagaatgtcttctgagcacagcctttcc
aaggtcatgttaactgttgctgtatcttcacctgcttctctgaatcctgaccaggaggga
ccctataacagtttgagtacccagcctattgtagcagcagtcacagacgtaacacatggt
tctctggattatttagataaccagttatttgcagctaaaagtcaggaagcagttagctta
ggaaattcaccttcttcctctataaataccaaagaacctgagataatcaaagcagatgca
gccatgggaactactgtcgttcctggtgttgattctacaggagacatggagcctgatagg
gagagaccctcagagatggcagctgatgatggccagagcactaccaccaagtatttggtg
acaatccccaataatttcctgactactgagccaacagctggcagtattttgggggatgct
aaggtcacagtgagtgtcagcacagctggcccagtctcttctatcttcaatgaggagtgg
gatgacaccaaatttgagagcataagtcgggggaggcccccagagccaggagacaatgca
gagactcaaatgagaacaaagccaccacatgggacctatgagagctttgaggggactgag
gagagcccctcttccacagcagttttaaaggtggctccagggcacctgggaggagaacca
gccttgggaacagccctggtgactgcactgggggatgagaggtctccagtcttgactcat
cagatttccttcactcccatgagtctggcagaagaccctgaagtttctaccatgaagctg
tttccaagtgcaggaggcttcagagcctccacccagggggacaggacccagctctcctca
gagactgcattttctacctctcaatatgagtctgtgccacagcaggaagcaggaaatgtg
ttaaaagacatcactcaagagagaaaaatggctactcaagcaatgaacactacatcacct
gtggtgacacaagagcatatggccaccatcgaggttcccagaggcagtggggagcctgaa
gaaggcatgccatccctgtctcctgtgcctgctgaagtggctgatgctgagctgtccaga
agaggggagtctctggccactccagcctccaccactgttgtccctttgtctctcaaactt
acctcttccatggaagatctcatggacacaatcactggaccaagtgaagaattcatacca
gtattgggctctccaatggcaccccctgcaatgactgtggaggctcccacaatttcttca
gcactcccttctgagggaagaactagtccatctatcagccgcccaaatacagctgcctcc
tatggcctagaacaacttgaatctgaagaggtagaagatgatgaggatgaagaggatgaa
gaagatgaagaggaagaagaagaagatgaggaagatgaagaagatgaggaagataaagag
acagactccttgtataaagacttcgatggtgatactgaaccaccagggtttactctgcct
ggcatcacgtcccaggaacctgacatacgttcaggaagcatggacctactagaggtagcc
acctaccaggtgccagagaccatcgagtgggaacagcagaatcaaggtctggtgagaagc
tggatggaaaagctaaaagacaaggcaggctacatgtctggaatgctggtgcctgttggg
gtagggatagctggagccttgttcatcttgggagcgctatacagcattaaggttatgaat
cgccgaagaagaaatggattcaaaaggcataaaaggaagcagagagaattcaacagtatg
caagacagagtgatgctgttagctgatagctctgaagacgaattctga

DBGET integrated database retrieval system