KEGG   Mus musculus (mouse): 67422
Entry
67422             CDS       T01002                                 

Gene name
Dhdds, 3222401G21Rik, CIT, DS, HDS, W91638, cis-IPTase
Definition
(RefSeq) dehydrodolichyl diphosphate synthase
  KO
K11778  ditrans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.87]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    67422 (Dhdds)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mmu01006]
    67422 (Dhdds)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.87  ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific]
     67422 (Dhdds)
Prenyltransferases [BR:mmu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   67422 (Dhdds)
SSDB
Motif
Pfam: Prenyltransf Ten1_2 DUF480
Other DBs
NCBI-GeneID: 67422
NCBI-ProteinID: NP_080420
MGI: 1914672
Ensembl: ENSMUSG00000012117
Vega: OTTMUSG00000009801
UniProt: Q99KU1
Position
4; 4 D2.3
AA seq 333 aa
MSWIKEGELSLWERFCANIIKAGPVPKHIAFIMDGNRRYAKKCQVERQEGHTQGFNKLAE
TLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLLDLARQKFSCLMEEQEKLQKHGVCIRV
LGDLHLLPLDLQEKIAHAIQATKNYNKCFLNVCFAYTSRHEIANAVREMAWGVEQGLLEP
SDVSESLLDKCLYSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNL
CEAILQFQRNHGALQKARDMYAEERKRRQLERDQAAVTEQLLREGLQASGDAQLRRTRLH
KLSTKREERVQGFLKALELKRANWLALWGTASA
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtcatggatcaaagaaggagagctgtcactgtgggaacggttctgtgctaacatcata
aaggctggcccagtacccaaacatatcgcgttcataatggacggcaaccgtcgctatgcc
aagaagtgtcaggtggagcgccaggagggccacacacagggcttcaataagcttgctgag
actctccgctggtgtttgaacctgggcatcctagaagtgactgtctacgcattcagcatt
gagaacttcaaacgttccaagagtgaggttgacggactcctggatctagccagacagaag
ttcagctgcttgatggaagaacaggagaagctgcagaagcacggggtgtgcatccgcgtc
ctgggtgatctgcatctgctgcccttggacctccaggagaagattgcgcatgccatccag
gctactaagaactacaataagtgtttcctcaatgtctgctttgcatacacatcacgtcat
gagattgccaatgctgtgagagagatggcctggggcgtggaacaaggtctgctggaaccc
agtgatgtctccgagtctctgctcgataagtgcctctatagcaaccactctcctcatccc
gacatcctgatccggacttctggggaggtgcggctgagtgacttcttgctctggcagacg
tcccattcctgcctcgtgttccagcctgtcctgtggccagaatacacattttggaacctg
tgtgaggcaattctgcagtttcagaggaaccatggtgcacttcagaaggcccgagacatg
tacgctgaggagcggaagaggcgccagctggagagggaccaggccgcagtgacagagcag
ctgcttcgagaggggctccaggccagtggggatgcccaactccgacggacacgcttgcac
aaactctccaccaaacgggaagagcgagtccaaggcttcctgaaggccttggaacttaaa
cgggccaactggctggcactttggggcactgcatctgcctaa

DBGET integrated database retrieval system