KEGG   Mus musculus (mouse): 67425
Entry
67425             CDS       T01002                                 

Symbol
Eps8l1, 2310051G19Rik, 4632407K17Rik, AW060268, DRC, DRC3, EPS, EPS8R1
Name
(RefSeq) EPS8-like 1
  KO
K17277  epidermal growth factor receptor kinase substrate 8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67425 (Eps8l1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    67425 (Eps8l1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    67425 (Eps8l1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   67425 (Eps8l1)
SSDB
Motif
Pfam: PTB SAM_3 SH3_1 SH3_9 SH3_3 SH3_4
Other DBs
NCBI-GeneID: 67425
NCBI-ProteinID: NP_001277345
MGI: 1914675
Ensembl: ENSMUSG00000006154
Vega: OTTMUSG00000035448
UniProt: Q8R5F8
Structure
PDB: 
2CY5 2CY4

Position
7; 7 A1
AA seq 716 aa
MSTTTGPEAAPKPSAKSIYEQRKRYSTVVMADVSQYHVNHLVTFCLGEEDGVHTVEDASR
KLAVMDSQGRVWAQEMLLRVSPSQVTLLDPVSKEELESYPLDAIVRCDAVMPRGRSRSLL
LLVCQEPERAQPDVHFFQGLLLGAELIREDIQGALQNYRSGRGERRAAALRATQEELRRG
ASPAAETPPLQRRPSVRLVINTVEPSAVRGRPQVESIPETEEARKPDQARTTSSADPTSP
DLGPRGPELAGLQAERDVDILNHVFDDVESFVSRLQKSAEATRVLEHRERGRRTRRRAAG
EGLLTLRAKPPTEAEYTDVLQKIKYAFSLLARLRGNIANPSSPELLHFLFGPLQMIVNTS
GGPEFAKSVRRPHLTLEAVTLLRDNVTPGENELWTSLGDSWTCPGVELPPEEGSPYSPEF
YNGWEPPATDPQGRPWEDPVEKQLQHEKRRRQQSAPQVAVNGQQDPELETESQLEEKARK
WVLCNYDFQARNGSELSVKHRDVLEVLDDRRKWWKVRDHQGQEGYVPYNILTPHPGPQVH
RSQSPARHLETSTPPPPPAPAPAPTQVRPQWDSCDSLNSLDPSEKEKFSQMLCVNEELQS
RLAQGRSGPSRVTPGPRAQEPQLSPRSEASVVRAWLQTKGFSSGTVEALGVLTGAQLFSL
QKEELRAVCPEEGARVYSQVTVQRALLEDREKVSELEAVMEKQKKKVEGETKTEVI
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgagcaccaccacagggcctgaagctgcacccaaaccaagtgcaaagtctatctatgaa
cagagaaaacgttactccaccgtggttatggctgacgtgtcccagtatcatgtcaatcac
ctggtcaccttctgcttgggggaagaagatggcgtgcacactgtggaagatgcttccaga
aagctggcagtcatggacagccaggggcgtgtctgggcacaggagatgctactgagagtg
tcacctagtcaagtcactctgcttgatccagtctccaaggaagaactagagtcatatcct
ctcgatgccatcgtacgctgcgacgcggtgatgccccgaggacggagccgttcattgctg
ctcctggtgtgccaggagccagagcgtgcacagccggatgttcatttcttccagggcctg
ctcctcggagcggagctgatccgtgaggacatccaaggggctctgcagaactaccgctcc
ggacgtggagaacgcagggcagcagcgctcagggcgacgcaggaggagctgcgacgcggc
gcctctccagcagcggagaccccgcccttacagcgtcgcccgtctgtccgcctggtgatc
aacaccgtggaaccatccgcagtccgcgggcgaccccaagtggagtcaattccagagact
gaggaagcaaggaaacccgaccaagctcgcacgactagcagtgctgaccctacctcccca
gacttgggcccaagaggacctgagctggcgggtctgcaggcagagcgggatgtggatatt
ctgaaccacgtgtttgacgacgtggagagttttgtatccagactgcaaaaatcagcagag
gctacccgggttttggagcaccgcgagagaggccgcaggacacgacgccgagctgcggga
gagggtctgctgacactgagggccaagccacccactgaggctgagtacaccgacgtgctt
cagaaaatcaaatacgccttcagtctgctggcccggttgcgaggcaacatcgccaacccc
tcctctccagagctgttgcactttctgtttggacctctgcagatgattgtgaacacttca
ggcggccctgagttcgcgaagagtgtgcgacgaccgcatttgacgttggaggctgtgact
ctgctccgcgacaatgtcactcctggtgaaaatgaactatggacctcgctgggagactcc
tggacctgcccaggggtggagctgcccccggaagaagggtctccatacagtccggaattc
tacaatggctgggagcctccggccactgatccacagggccgcccctgggaggacccagtg
gaaaaacagctacaacacgagaagcggcgcaggcagcaaagcgccccccaggtcgcggtc
aatggtcagcaagatccagaactggaaactgagtcccagctagaagagaaagccagaaaa
tgggttctgtgtaattatgacttccaggcccgaaatggcagcgagctatctgtcaagcac
cgagatgtgttggaggtcctggatgacaggcgcaaatggtggaaggttcgggaccatcag
ggacaagagggctatgtaccctataatatcctgacaccccaccctggacctcaggtgcac
cgcagccaaagccccgcaagacacctagagactagcacacctcctcccccacctgcccca
gctccagccccaactcaggtgcggccccagtgggacagttgcgacagtctaaacagtttg
gatcccagcgagaaggagaaattctcccagatgctttgtgtcaatgaggagctgcagtcg
cgcctggcgcagggccgttcgggtcccagccgggtaaccccggggccccgagcccaagag
ccccagctcagcccgcgctctgaggcctcggtggtccgtgcctggctgcagaccaagggc
tttagctccgggactgtggaggcgctcggtgtgctgaccggcgcacagctcttctcgctg
caaaaggaagagttgcgggcggtgtgccccgaggaaggggcgcgagtgtacagccaagtc
actgtgcagcgcgcgctgctggaggacagagaaaaagtatcagagctggaggccgtgatg
gagaagcaaaagaaaaaagtggaaggcgagaccaaaacagaagtcatttga

DBGET integrated database retrieval system