KEGG   Mus musculus (mouse): 67434Help
Entry
67434             CDS       T01002                                 

Gene name
Ankrd33b, 0610012A05Rik, 3021401C12Rik, 5730557B15Rik
Definition
(RefSeq) ankyrin repeat domain 33B
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank
Motif
Other DBs
NCBI-GeneID: 67434
NCBI-ProteinID: NP_001157913
MGI: 1917904
Ensembl: ENSMUSG00000022237
Vega: OTTMUSG00000032733
UniProt: Q3U0L2
Position
15; 15 B2
AA seq 486 aa AA seqDB search
MVLLAGPGPEGGGTRCLSPQSPTPPRSEQTGEDPADYEEYEDFSSLPDTRSIASDDSFYP
PGGEEEYGSVSAESVPEGVPEAATLLRAACANDVGLLRALVRRGPSSEEVRETDRNGRTG
LIVACYHGFVDTVVALAECPHVDVNWQDSEGNTALITAAQAGHVTITNYLLNYFPGLDLE
RRNIFGFTALMKAAMQGRTECVRALMMAGADVQARDPRRGLSPQEWAAYTGRAEAVRVIQ
RLMERPCPEQFGDKYKLELPLPAEAVLKKSGSKNCLQRFTAFLRSTLTSRSSGQSLEDGG
VLDHMVRMTTSLYSPAVAVVCQTVCPENPPCVGKRRLAVQEILAARGNLNAQAQDSNKVE
CSEPQSQILETPRASSRSPKSPAASRSTPAPVTRKASLLPLQLLRRSSVRPGVVVPRVRI
SKAPAPTFQPERAASKGNTKDSIYLQIPKWRYKEAKEEKRKAEEAEKKRQAEAQKEKRAP
RWRKRT
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgctggctgggcccgggccggagggcggcgggacacgctgcttgtccccgcag
tcgccgacgccaccccgtagcgagcagacaggagaagacccagcggactacgaggagtac
gaagacttctctagtctgccggacacccgcagcatcgcatcggacgattccttctaccct
cccggaggcgaggaagagtacggctcggtgagcgcggagagcgtcccggagggcgtccct
gaggcggcgaccctcctgcgcgccgcctgcgccaacgacgtggggttgctgcgggcgcta
gtgcggcgcgggccgagttccgaggaggtacgggagactgaccgcaacggccggactggc
cttattgttgcgtgctaccatggctttgtggataccgtggtggccttagcagagtgtccc
cacgttgacgtcaactggcaggacagcgaagggaacacagccctgatcactgctgcacag
gcagggcatgtcaccatcaccaactacttgctgaattatttccctggtctggacctagaa
aggaggaacatatttggattcacggccctcatgaaagcggccatgcagggcagaacggaa
tgtgtgcgagcccttatgatggcaggggcagatgttcaagcaagggatccccgtcgtggg
ctgtcaccacaggagtgggctgcgtacacaggccgagcggaggctgttcgcgtcattcag
aggctgatggagcgaccctgtccagagcagtttggggacaagtacaagctggaattgcca
cttcccgctgaggcggttttgaagaagtcaggttccaaaaactgcttgcagagattcacc
gcgttcctgcggtccactctgacctctcgctcctcaggccagagcctggaggatgggggc
gtccttgatcacatggtcaggatgaccacgagcctctacagtcccgctgttgctgtagtc
tgtcagacagtgtgccctgagaaccctccctgtgtggggaaacgacgcttggcggtgcag
gaaatcctagcagctaggggcaacctgaacgcccaagcgcaggacagcaacaaggtagag
tgctctgagccacaatcccagattttggagactcccagagctagctcccggtctcccaag
tcgcccgcggcatcgaggtccactcctgcccctgtcactcggaaggccagcctcctgcct
ttgcagttgcttcggagaagcagcgtgcggccgggcgtggtagtccccagagtgcgcatc
agcaaggcacctgcgcccaccttccagccagagcgcgcagcgtccaagggcaacaccaag
gacagcatctacctgcagatccccaagtggcggtacaaggaggccaaggaggagaagagg
aaggcagaggaggcggagaagaagcgccaggcagaggctcagaaagaaaagcgggcgcca
cgatggaggaaaaggacgtga

DBGET integrated database retrieval system