KEGG   Mus musculus (mouse): 67439
Entry
67439             CDS       T01002                                 

Gene name
Xab2, 0610041O14Rik, AV025587
Definition
(RefSeq) XPA binding protein 2
  KO
K12867  pre-mRNA-splicing factor SYF1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    67439 (Xab2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    67439 (Xab2)
   03041 Spliceosome [BR:mmu03041]
    67439 (Xab2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     67439 (Xab2)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19-related factors
    67439 (Xab2)
 Complex C
    67439 (Xab2)
SSDB
Motif
Pfam: TPR_14 TPR_12 TPR_2 TPR_19 TPR_8 Suf TPR_15 TPR_1 RPN7 TPR_7 TPR_21 PPR DHR-2 TPR_16
Other DBs
NCBI-GeneID: 67439
NCBI-ProteinID: NP_080432
MGI: 1914689
Ensembl: ENSMUSG00000019470
Vega: OTTMUSG00000034606
UniProt: Q9DCD2
Position
8 A1.1; 8 1.92 cM
AA seq 855 aa
MVVMARVPRSERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERA
LKLLPCSYKLWYRYLKARRAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFL
MDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESA
EEYIEYLKSSDRLDEAAQRLATVVNDERFVSKAGKSNYQLWHELCDLISQNPDKVQSLNV
DAIIRGGLTRFTDQLGKLWCSLADYYIRSGHFEKARDVYEEAIRTVMTVRDFTQVFDSYA
QFEESMIAAKMETASELGREEEDDVDLELRLARFEQLISRRPLLLNSVLLRQNPHHVHEW
HKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVAFAKFYEDNGQLDDARVILEK
ATKVNFKQVDDLASVWCQCGELELRHENYDEALKLLRKATALPARRAEYFDGSEPVQNRV
YKSLKVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFKA
YERGISLFKWPNVSDIWSTYLTKFISRYGGRKLERARDLFEQALDGCPPKYAKTLYLLYA
QLEEEWGLARHAMAVYDRATRAVEPAQQYDMFNIYIKRAAEIYGVTHTRGIYQKAIEVLS
DEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTI
REMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLA
AEAERDQPPRAQSKIFFVRSDASREELAELAQQANPEEIQLGEDEDEDEMDLEPNEVRLE
QQSVPAAVFGSLKED
NT seq 2568 nt   +upstreamnt  +downstreamnt
atggtggtgatggcgcgagttccgcgttccgagcggccggaccttgtttttgaggaagag
gaccttccctatgaggaagaaatcatgaggaaccagttctccgtcaaatgctggctccgc
tacatcgagttcaaacagggggcccccaagccccgactcaaccagttgtatgagcgggca
ctcaaactgcttccctgcagctacaaactctggtaccgatatctgaaggcacgccgggca
caggtgaaacatcgctgtgtgactgatcctgcctatgaagatgtcaacaactgccatgag
agggcctttgtgttcatgcacaagatgccacgcctgtggttagactactgccagtttctc
atggaccagggaagggtaacacatacccgccgcacctttgaccgtgccctcagggcactg
cccatcacacaacactctcgcatctggcccctgtatctacgtttcctgcgctcccaccca
ctgcctgagactgctgtgcgaggctaccgtcgcttcctcaagctgagtcctgagagcgct
gaggaatacatcgagtatctcaaatccagtgaccggctagacgaggctgcacagcgcctg
gccaccgtggtgaatgatgagcgctttgtatccaaggctggtaaatccaactaccagctg
tggcacgagctgtgtgaccttatctcccagaatccggacaaggtacagtctctcaatgtg
gatgccataatccgtggtgggctcacccgtttcactgaccagctgggcaagctgtggtgc
tctttggcagactactatatccgcagtggccacttcgaaaaggctcgggatgtgtatgag
gaggccatccgcacggtgatgaccgtgcgggacttcacccaggtgttcgacagctacgcc
cagtttgaggagagcatgattgcagcgaagatggagactgcctctgaactggggcgtgag
gaggaggacgatgtggacctagagctgcgcctggcccgcttcgaacagctcatcagccga
cggcccctgcttctcaatagtgtccttctgcgccagaacccacaccacgtccacgagtgg
cacaagcgtgtagccctccatcagggccgccctcgggagattatcaacacatacacagag
gctgtgcaaacagtagaccccttcaaagccacaggcaagccccacacactgtgggttgca
ttcgccaagttttacgaagacaatggacagctggatgatgctcgtgtcatcctagagaag
gccaccaaggtgaacttcaagcaggtggatgacctggcaagtgtgtggtgccagtgtggg
gagctagagctcaggcacgagaattacgatgaggccttaaagctgctgcggaaagccacg
gctttgcctgcccgccgagctgagtactttgatggttcagaacctgtgcagaaccgtgta
tataagtcgctgaaggtgtggtccatgcttgccgacttggaggaaagcctgggcactttc
cagtcaaccaaggccgtgtatgaccgaatcctggacctgcgcatagccacgccacagatc
gttattaactatgccatgttcctggaggagcacaagtactttgaggagagcttcaaggca
tatgagcgtggcatctcactgttcaagtggcccaatgtttcagacatctggagcacctac
ctgaccaaattcatctcgcgctatgggggccgaaagctggagcgtgcacgggatctcttt
gagcaggcactcgatggctgcccaccaaaatatgccaagactttatacctgctctacgca
cagctggaggaggagtggggccttgcccgccatgccatggctgtgtatgaccgtgcgacc
agggcagtggagccagcacagcagtacgacatgtttaacatctacatcaagcgagctgct
gagatctatggcgtcacccacactcgtggcatctaccagaaggccattgaggtgctgtct
gatgagcatgcccgtgagatgtgcctgcggtttgcagacatggagtgcaagctcggtgaa
atcgaccgcgcccgggccatctacagcttctgctcccagatctgtgatccccggacaact
ggggcattctggcaaacatggaaggactttgaggttcggcacggcaatgaggataccatc
agggagatgctgaggatacggcggagtgtgcaggccacatacaatactcaggtcaacttc
atggcttcacagatgctcaaggtgtcgggcagtgccacaggcaccgtgtctgacctggct
cctgggcagagtggcatggatgacatgaagctgctggaacagagagcagaacagctggca
gctgaggcggagcgggaccagccccccagggcccagagcaagatcttctttgtgaggagt
gatgcatccagggaggaattggcagagctggctcagcaggccaaccctgaggagatccag
ctgggcgaggatgaggacgaggacgagatggacctggagcccaatgaagtccgactggaa
cagcagagtgtaccagctgctgtgttcgggagcctaaaggaagactga

DBGET integrated database retrieval system