KEGG   Mus musculus (mouse): 67441
Entry
67441             CDS       T01002                                 

Gene name
Isoc2b, 0610042E07Rik, AI553388, Isoc2
Definition
(RefSeq) isochorismatase domain containing 2b
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Isochorismatase
Other DBs
NCBI-GeneID: 67441
NCBI-ProteinID: NP_080434
MGI: 1914691
Ensembl: ENSMUSG00000052605
Vega: OTTMUSG00000023222
UniProt: Q9DCC7
Position
7; 7 A1
AA seq 210 aa
MGAAKASLGRIFPESSILFLCDMQEKLRDRILYFPQIVSKAARMLKVAQMLEIPVLLTEH
YPQGLGPTVPELGAQGLRTMSKTSFSMVPPLQQELDKLPQLQSVLLCGIETQGCILHTAL
DLLDRGLQVHVAVDACSSQSEMNRLVALARMQQSGVFLSTSEVLILQLVKDAAHPQFKEI
QKILKEPVTDIGLLGFFQGKKNSLLPNSRT
NT seq 633 nt   +upstreamnt  +downstreamnt
atgggagcagccaaagctagcctcggccggatcttcccagagtcctccatcctgttccta
tgtgacatgcaggagaaacttcgagatagaatcctctacttcccacagatcgtgtcaaag
gccgctcggatgcttaaggtagcccagatgctagaaatccccgtcttgctgacagagcat
tacccacaaggtctgggccccacagttcccgagctgggtgctcagggtctgcgaaccatg
agcaaaacgtccttcagcatggtgcccccgcttcaacaggagttggacaaactgccccag
ctgcagtccgtgctactctgtggcattgagacccaaggctgcatcttgcacacagctctg
gacctcctggaccgtgggctacaggttcatgtagcagtggatgcctgttcttctcaaagt
gagatgaaccggctcgtggcactggcccgaatgcagcagagtggcgtctttctgtccacg
agcgaggtgctgattctccagctggtgaaggatgctgcccacccacagttcaaggagatt
cagaagatcctcaaggagccagtcacagacatcggactgttaggcttcttccaaggcaag
aaaaactccctgttgcccaactccaggacctga

DBGET integrated database retrieval system