KEGG   Mus musculus (mouse): 67443
Entry
67443             CDS       T01002                                 

Gene name
Map1lc3b, 1010001C15Rik, Atg, Atg8, LC3, LC3b, MAP1A/MAP1B, Map1, Map1lc3
Definition
(RefSeq) microtubule-associated protein 1 light chain 3 beta
  KO
K10435  microtubule-associated protein 1 light chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    67443 (Map1lc3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67443 (Map1lc3b)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    67443 (Map1lc3b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    67443 (Map1lc3b)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    67443 (Map1lc3b)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    67443 (Map1lc3b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     67443 (Map1lc3b)
SSDB
Motif
Pfam: ATG8 APG12 Rad60-SLD
Other DBs
NCBI-GeneID: 67443
NCBI-ProteinID: NP_080436
MGI: 1914693
Ensembl: ENSMUSG00000031812
Vega: OTTMUSG00000043032
UniProt: Q9CQV6
Structure
PDB: 
5WRD 5YIS 5YIQ

Position
8; 8 E1
AA seq 125 aa
MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFG
TAMAV
NT seq 378 nt   +upstreamnt  +downstreamnt
atgccgtccgagaagaccttcaagcagcgccggagctttgaacaaagagtggaagatgtc
cggctcatccgggagcagcaccccaccaagatcccagtgattatagagcgatacaagggg
gagaagcagctgcccgtcctggacaagaccaagttcctggtgcctgaccacgtgaacatg
agcgagctcatcaagataatcagacggcgcttgcagctcaatgctaaccaagccttcttc
ctcctggtgaatgggcacagcatggtgagtgtgtccactcccatctccgaagtgtacgag
agtgagagagatgaagacggcttcctgtacatggtttatgcctcgcaggagacattcggg
acagcaatggctgtgtaa

DBGET integrated database retrieval system