KEGG   Mus musculus (mouse): 67446
Entry
67446             CDS       T01002                                 

Gene name
Dusp28, 0710001B24Rik, AV005521
Definition
(RefSeq) dual specificity phosphatase 28
  KO
K14165  atypical dual specificity phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    67446 (Dusp28)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     67446 (Dusp28)
    3.1.3.48  protein-tyrosine-phosphatase
     67446 (Dusp28)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Atypical DSPs
    67446 (Dusp28)
SSDB
Motif
Pfam: DSPc Init_tRNA_PT DUF442 Y_phosphatase
Other DBs
NCBI-GeneID: 67446
NCBI-ProteinID: NP_780327
MGI: 1914696
Ensembl: ENSMUSG00000047067
Vega: OTTMUSG00000048631
UniProt: Q8BTR5
Structure
PDB: 
2HCM

Position
1; 1 D
AA seq 163 aa
MGTSEAAPPPFARVAPALFIGNARAAGATELLVRAGITLCVNVSRQQPGPRAPGVAELRV
PVFDDPAEDLLTHLEPTCAAMEAAVRDGGSCLVYCKNGRSRSAAVCTAYLMRHRGHSLDR
AFQMVKSARPVAEPNLGFWAQLQKYEQTLQAQAILPREPIDPE
NT seq 492 nt   +upstreamnt  +downstreamnt
atgggcacctcggaggctgcaccgccgcctttcgcgcgcgtcgcccccgcgctcttcatc
gggaatgcgcgagccgcgggtgcgacggagctgctggtgcgcgcgggcatcactttgtgc
gtcaatgtctcccgccagcagcccgggccgcgcgcgcccggagtggcggaactacgcgta
cccgtgttcgacgacccagctgaggacctgctgacacacctggagcccacctgtgccgcc
atggaagccgcggtgcgcgacggcggctcctgtctcgtgtactgcaagaacggccgcagt
cgctcagccgccgtctgcaccgcctacctaatgcggcaccgcggccacagcctggatcgc
gccttccagatggtgaagagcgcccgcccggtagccgagcccaatttggggttctgggct
cagctgcagaagtacgagcagacccttcaggcccaggccatcctgccccgggagcccatt
gatccggagtaa

DBGET integrated database retrieval system