KEGG   Mus musculus (house mouse): 67451
Entry
67451             CDS       T01002                                 
Symbol
Pkp2, 1200008D14Rik, 1200012P04Rik, AA516617, Pkp2l
Name
(RefSeq) plakophilin 2
  KO
K12642  plakophilin 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    67451 (Pkp2)
SSDB
Motif
Pfam: Arm HEAT_2 V-ATPase_H_N SelP_C Atx10homo_assoc
Other DBs
NCBI-GeneID: 67451
NCBI-ProteinID: NP_080439
MGI: 1914701
Ensembl: ENSMUSG00000041957
UniProt: Q9CQ73
Position
16:16031209..16090576
AA seq 795 aa
MAVPGSLAECGYIRTVLGQQILGHLDSSSLALPSEARLRLAGSSGRGDPAARSQRIQEQV
QQTLARRGRSSAVSGNLHRTSSVPEYVYKLHVVENDFVGRQSPVTRDYDMLKAGMTATYG
SRWGRAAAQYSSQKSVEERSWRQPLRRLEISPDSSPERAHYGHSEYQYAWRSHVVPGGRL
TLPRYARSEILGLRQAGTARRPPGCGSFSDAVFDNGPLKPTMPTHPPGTSHSAGSLLEET
TVRVSQARLQSTQSRTARSSWPRSSVRSSLREPGRMLTTAGQAAVGSGDAHGDRSVFADA
QLGNADIEMTLERAVNMLDADHVPVSKISAAATFIQHESFQKSEARKRVNQLRGIPKLLQ
LLKLQNEDVQRAACGALRNLVFEDNDNKLEVAELNGVPRLLQVLKQTRDLETKKQITGLL
WNLSSSDKLKHLMITEALLTLTESVIIPFSGWPEGDYPKANGLLDFDIFYNVTGCLRNMS
SAGPDGRKMMRRCDGLIDSLVHYVRGTIADYQPDDKATENCVCILHNLSYQLEAELPEKY
SQSIYMQNRNIQTNSNKSIGCFGSRSRKLKEQYQDLQMPEERSNPHGIEWLWHSIVIRMY
LSLIAKSTRNYTQEASLGALQNLTAGGGPIPTLVARMVVQKENGLQHTRKMLHVGDPSVK
KTAVSLLRNLSRNLSLQNEIAKETLPDLVSIIPDTVPSTDLLIETTASACYTLNNLMQNS
YQNARDLLNTGGLQKIMTISIGEGYAPNKASKAASVLLYSLWAHTELHHAYKKAQFKKTD
FVNSRTAKAYHSLKD
NT seq 2388 nt   +upstreamnt  +downstreamnt
atggccgtccccggctcactggccgagtgtggctacatccggactgtgctgggccagcag
atcctgggtcacctggacagctccagcctggccttgccctccgaggccagactgaggctg
gccggcagcagcggccgcggcgacccggcggcccggagccagcggatccaggagcaggtg
cagcagaccctggcccgccggggccggagctctgcggtcagcgggaaccttcaccgaacc
agcagtgtccctgagtatgtctacaagctacacgtggttgagaatgactttgttggacgg
cagtcacctgtcactagggactatgacatgcttaaggctggaatgactgccacttatgga
agtcgctgggggagagcagcagcacagtacagttcccagaagtcagtggaggagagatcc
tggaggcagcctctgaggagacttgagatttccccagatagcagcccggagagagcccac
tatgggcacagcgaataccagtatgcctggcggagccacgtggtgcctggtgggcgcctc
accctgccacgctatgctcgctcagagatcctgggcctacgccaggctggcacagcccgc
aggccacctgggtgcgggtcattcagcgatgctgtcttcgacaatggcccactcaagccc
acaatgcccacccaccctcctggcaccagccacagtgcgggcagcttgttggaagagacc
actgtgcgcgtgagccaggctcggcttcaaagcacgcagagcagaaccgcccgctcctcc
tggcccaggagctcagtccgcagtagcctgcgggagccaggaagaatgctgaccaccgca
ggccaggctgccgtgggcagcggggatgcacatggggacaggagtgtcttcgctgacgcc
cagctggggaatgcagacatcgaaatgaccttggagagagctgtgaatatgctggatgca
gaccatgtaccagtatccaagatctctgccgcagctaccttcatacagcatgagagcttc
caaaaatctgaagcacggaaaagggtcaatcaacttcgaggcatccctaagcttctacaa
ctgctcaaacttcagaacgaagatgttcaacgggctgcttgtggggccttgagaaacttg
gtatttgaagacaatgataacaagttggaggtagctgaactgaatggagtgcctcggcta
ctgcaggtgctgaagcaaaccagagacttggagacaaaaaagcaaataacaggtttgctc
tggaacctgtcctctagtgataaactcaagcatctcatgataacagaagccttgctcacc
ttgacagagagtgtcatcatccccttctccgggtggcctgaaggcgactaccccaaagcc
aatggcttgcttgattttgatatattctacaatgtcactggatgcctaaggaacatgagc
tctgctggccccgatgggaggaagatgatgagaaggtgtgatggtctcattgactcattg
gtccactatgtcagaggaactattgcagactaccagccagatgataaggccacagagaac
tgtgtgtgcattcttcataacctctcctaccagctggaggcagagctcccagagaaatat
tcccagagtatctacatgcaaaaccggaatatccagactaacagtaacaaaagtattggg
tgttttggcagccgaagtaggaaactaaaagagcaataccaagacttgcagatgccagag
gaaaggagcaatccacatggcattgagtggctgtggcattccattgtgataaggatgtat
ttgtccttaattgccaagagtacccgaaactatacccaagaggcatcacttggggctctc
cagaacctcacagcaggaggcggcccgatacccacattggtggctcgaatggttgtccaa
aaggaaaatggtcttcagcatacacggaagatgctgcacgtgggtgatcccagtgtgaaa
aagactgcggtctccctgctgaggaatttgtcacggaatctttccctgcagaatgaaatt
gctaaagaaactctaccagatttggtttctataattcctgacacagtcccaagtactgac
cttctcattgaaaccacagcctctgcttgctatacgttgaacaatttaatgcaaaatagt
taccagaatgcacgagaccttctgaacaccggaggtctgcagaaaattatgaccatcagc
ataggggaaggctatgcccccaacaaggccagcaaagcagcctctgtcctcctttactct
ctgtgggcacatacagagctgcatcacgcctataagaaggctcagtttaagaaaacagac
tttgtcaacagccggactgccaaagcctaccactctcttaaagactga

DBGET integrated database retrieval system