KEGG   Mus musculus (mouse): 67458
Entry
67458             CDS       T01002                                 

Gene name
Ergic1, 1200007D18Rik, maa-136
Definition
(RefSeq) endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1
  KO
K20365  endoplasmic reticulum-Golgi intermediate compartment protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67458 (Ergic1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    67458 (Ergic1)
SSDB
Motif
Pfam: ERGIC_N COPIIcoated_ERV
Other DBs
NCBI-GeneID: 67458
NCBI-ProteinID: NP_080446
MGI: 1914708
Ensembl: ENSMUSG00000001576
Vega: OTTMUSG00000035774
UniProt: Q9DC16 Q4FK22
Position
17; 17 A3.3
AA seq 290 aa
MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDD
PDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQ
FSINKVPGNFHVSTHSATAQPQNPDMTHTIHKLSFGDTLQVQNVHGAFNALGGADRLTSN
PLASHDYILKIVPTVYEDKSGKQRYSYQYTVANKEYVAYSHTGRIIPAIWFRYDLSPITV
KYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEAWKKIQLGKIH
NT seq 873 nt   +upstreamnt  +downstreamnt
atgccctttgacttcaggaggtttgacatctacaggaaggtgcccaaggacctcacacag
ccgacatatactggtgccattatctccatctgctgctgcctcttcatcctcttcctcttc
ctgtcggagctcactggattcatcacaacagaagtggtgaatgagctctacgtcgatgac
ccagacaaggacagcggaggcaaaattgacgtcagtctcaacatcagtttacccaatttg
cactgtgaattggtcgggcttgacatccaagatgagatgggcagacacgaagtgggccac
atcgacaattccatgaagatcccgctgaataatggagccggctgccgcttcgagggccag
ttcagcatcaacaaggttcccggcaacttccatgtgtccacacacagtgccacagcgcag
ccacagaacccggacatgacacataccatccataaactctcctttggggatacgctacag
gtccagaatgttcacggggctttcaatgctcttgggggagcagacagactcacctccaac
cccctggcctcccatgactacatcttgaagattgtacccacagtgtatgaggacaagagc
ggcaagcagcgctactcctaccagtacacagtggccaacaaggagtacgttgcctacagc
cacacgggacgcattatccctgccatctggttccgctatgacctcagccccatcacagtc
aagtacacagagagaagacaacccctgtacaggttcatcaccacaatctgtgccatcatc
ggcggaaccttcactgtcgccggcattctggactcctgtatcttcacagcctcagaagcg
tggaagaagatccagctgggcaaaattcactga

DBGET integrated database retrieval system