KEGG   Mus musculus (house mouse): 67460
Entry
67460             CDS       T01002                                 
Symbol
Decr1, 1200012F07Rik, Decr, Nadph
Name
(RefSeq) 2,4-dienoyl CoA reductase 1, mitochondrial
  KO
K13236  2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial [EC:1.3.1.124]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    67460 (Decr1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.124  2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]
     67460 (Decr1)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR 3Beta_HSD
Other DBs
NCBI-GeneID: 67460
NCBI-ProteinID: NP_080448
MGI: 1914710
Ensembl: ENSMUSG00000028223
UniProt: Q9CQ62 Q4FJK0
Position
4:complement(15917240..15945377)
AA seq 335 aa
MALLGRAFFAGVSRLPCDPGPQRFFSFGTKTLYQSKDAPQSKFFQPVLKPMLPPDAFQGK
VAFITGGGTGLGKAMTTFLSTLGAQCVIASRNIDVLKATAEEISSKTGNKVHAIRCDVRD
PDMVHNTVLELIKVAGHPDVVINNAAGNFISPSERLTPNGWKTITDIVLNGTAYVTLEIG
KQLIKAQKGAAFLAITTIYAESGSGFVMPSSSAKSGVEAMNKSLAAEWGRYGMRFNIIQP
GPIKTKGAFSRLDPTGRFEKEMIDRIPCGRLGTMEELANLATFLCSDYASWINGAVIRFD
GGEEVFLSGEFNSLKKVTKEEWDIIEGLIRKTKGS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcgctgctgggccgtgcgttctttgctggggtgtcccgcctcccctgcgatccgggt
cctcagaggtttttcagctttggaacaaaaacactgtatcaaagcaaagatgctccacag
tctaaattcttccagcccgttttaaagcctatgctaccacctgatgcttttcaaggaaaa
gtggctttcattactggaggagggactggccttggcaaggcaatgacaactttcttgtct
accctgggtgcccagtgtgtgatagccagcagaaatattgatgttttgaaagcgactgca
gaagagatttcttctaaaactggaaacaaggttcatgcgattcggtgtgatgttcgagat
cctgatatggtacataacacagtgctggaactgatcaaagttgcagggcatccggatgtg
gtgataaacaacgcggcagggaacttcatttcccccagtgagagactgactcccaatggc
tggaagaccataactgacatagttctcaatggcacagcctatgtgacactagaaattgga
aagcagctaattaaagcacagaaaggagctgcgtttcttgccatcactaccatctatgct
gagagtggatcaggctttgtaatgccaagttcttcagccaaatcaggcgtggaagccatg
aataagtcacttgcagctgaatggggtagatatggaatgcgtttcaacataattcagcca
ggacctatcaaaaccaaaggagcctttagccgtttggacccgactggaagatttgagaag
gagatgattgacagaatcccctgtggtcgtctgggaactatggaggaacttgcaaatctg
gccactttcctatgcagtgattatgcctcttggattaatggagcagtcattagatttgac
ggtggagaggaagtatttctgtcaggtgaattcaactctctaaagaaggtcaccaaggag
gagtgggatataatcgaagggctcatcaggaagacaaaaggctcctaa

DBGET integrated database retrieval system