KEGG   Mus musculus (mouse): 67465
Entry
67465             CDS       T01002                                 

Gene name
Sf3a1, 1200014H24Rik, 5930416L09Rik, AI159724
Definition
(RefSeq) splicing factor 3a, subunit 1
  KO
K12825  splicing factor 3A subunit 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    67465 (Sf3a1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    67465 (Sf3a1)
Spliceosome [BR:mmu03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    67465 (Sf3a1)
 Complex B
    67465 (Sf3a1)
 Complex C
   U2 SnRNP specific factors
    67465 (Sf3a1)
SSDB
Motif
Pfam: PRP21_like_P Surp ubiquitin Ubiquitin_2 Rad60-SLD
Other DBs
NCBI-GeneID: 67465
NCBI-ProteinID: NP_080451
MGI: 1914715
Ensembl: ENSMUSG00000002129
Vega: OTTMUSG00000005059
UniProt: Q8K4Z5 Q3TVM1
Structure
PDB: 
1WE7

Position
11; 11 A1
AA seq 791 aa
MQAGPVQAVPPPPPVATESKQPIEEEASSKEDPTPSKPVVGIIYPPPEVRNIVDKTASFV
ARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQ
QQATQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQ
FLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVL
DQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTT
PEELGARILIQERYEKFGESEEVEMEVESDEEDQEKAEETPSQLDQDTQVQDMDEGSDDE
EEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKIPA
SKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEET
AIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTK
EKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPAMPPPVRTTVVSAVPVMPRPPM
ASVVRLPPGSVIAPMPPIIHAPRINVVPMPPAAPPIMAPRPPPMIVPTAFVPAPPVAPVP
APAPMPPVHPPPPMEDEPPSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKL
NGQGLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMASGAVIH
LALKERGGRKK
NT seq 2376 nt   +upstreamnt  +downstreamnt
atgcaggccggacccgtgcaggcggtacccccgccgccgccagtagccactgagtccaaa
cagccaattgaagaagaagcatcgtcaaaggaggatcccaccccttccaagccagtggtc
ggcattatttaccctcccccggaggtcaggaacatcgtcgacaagactgccagttttgtg
gccagaaatgggcctgaatttgaagctaggattcgacagaatgagatcaacaaccccaag
ttcaatttcttaaatcccaatgacccttaccatgcctactaccgccacaaggtcagcgag
ttcaaggaggggaaggctcaggagccctcagctgccatccccaaggttatgcagcagcag
cagcaagctacgcaacagcagctgccccagaaggtccaagcccaggtgatccaagagacc
atagtaccgaaggagccccctcctgagtttgagttcatcgctgatcccccctccatctca
gccttcgacctggatgtagtgaagctgacagctcagtttgtggccaggaatgggcgtcag
tttctgacccagctgatgcagaaagagcagcgcaactaccagtttgactttctccgaccc
cagcacagcctcttcaactacttcacaaagctggtggagcagtataccaagatcttgatt
ccacccaaaggcttattttcaaagctcaagaaagaggctgaaaatcctcgagaagttttg
gaccaggtttgttaccgagtagaatgggccaaatttcaggaacgtgagaggaagaaggaa
gaagaggagaaagagaaggagcgagtagcttatgctcagattgactggcatgattttgtg
gtggtggagacagtggattttcaacccaatgagcaaggaaactttccacccccaacaaca
ccagaggaactgggagctcggatcctcattcaggagcgctacgagaagtttggggagagc
gaggaagtggagatggaggttgagtcagatgaggaagatcaggagaaggccgaggagact
ccttcccagctggaccaggatactcaagtacaggacatggatgagggttcagatgatgaa
gaagaagggcagaaagtgcctccacccccagagacacccatgcctccacctctgccccca
acaccagaccaagtcattgtgcggaaggactatgatcccaaagcttccaagcccctccct
ccagcccctgctcccgatgagtatcttgtatcccccatcactggggagaagattcctgcc
agcaaaatgcaggagcacatgcgcattgggcttcttgacccccgctggctggagcagcgg
gaccgctccatccgagagaagcagagtgatgatgaggtttatgcaccaggtctggatatt
gagagcagcttaaagcagttggctgagcgacgtactgacatctttggggtagaagagaca
gccattggtaagaagattggtgaagaggagatccagaagccagaggagaaggtgacttgg
gatggccattcaggcagcatggcccggacccagcaggctgcccaggccaacatcaccctc
caggagcagattgaggccatccataaggccaagggcctggtgccggaagatgacactaag
gagaagattggccccagcaagcccaatgaaatccctcagcagccaccacctccatcttca
gccaccaatatccccagctcagcaccccccattacatcagtgccccggccacctgcgatg
ccacctccagtccgcaccactgttgtatctgcagtacctgtcatgcctcggccacccatg
gcatctgtggtccggctgcccccaggctcagtgattgcccccatgccacccatcatccac
gcacccaggatcaatgtggtacctatgcctcctgcagcacctcccatcatggcgccccgc
ccacctcccatgattgtgccaacagcctttgtgcctgccccacctgtggctccagtccca
gccccagctccaatgcctcctgtacaccccccacctcctatggaggatgagcctccatcc
aagaaactaaagaccgaggacagtctcatgcctgaggaagaattcctgcgcaggaacaag
ggtccagtatccatcaaagtgcaggtacccaacatgcaggataagacggaatggaagctg
aatggtcaggggctggtcttcactctcccactcacagaccaggtctctgtcatcaaagtg
aagattcatgaagccacgggcatgcctgcggggaaacagaaactacagtatgaaggcatc
ttcatcaaggattccaactccctggcttactacaacatggccagtggtgctgtcatccac
ttggccctcaaggagagaggcggcaggaagaagtag

DBGET integrated database retrieval system