KEGG   Mus musculus (mouse): 67471
Entry
67471             CDS       T01002                                 

Gene name
Gpatch1, 1300003A17Rik, ECGP, Gpatc1
Definition
(RefSeq) G patch domain containing 1
  KO
K13123  G patch domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    67471 (Gpatch1)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Complex C specific factors
    67471 (Gpatch1)
SSDB
Motif
Pfam: DUF1604 G-patch G-patch_2
Other DBs
NCBI-GeneID: 67471
NCBI-ProteinID: NP_080457
MGI: 1914721
Ensembl: ENSMUSG00000063808
Vega: OTTMUSG00000030960
UniProt: Q9DBM1
Position
7; 7 B2
AA seq 930 aa
MAALDSDSDEDLISYGTGLEPLDEGERPKKPIPLQDQTVRDEKGRYKRFHGAFSGGFSAG
YFNTVGSKEGWTPSTFVSSRQNRADKSALGPEDFMDEEDLSEFGIAPKAIVTTDDFASKT
KDRIREKARQLAAAAAPIPGATLLDDLITPAKLSVGFELLRKMGWKEGQGVGPRVKRKAR
RQKPDPGVKIYGCALPPGGSEESEDEDDDYLPDNVTFAPKDVMPVDFTPKDNVHGLAYKG
LDPHQALFGMPGEHLNLFGGASEGTSHLLGDVGLSKGRKLGISGQAFGVGALEEEDDDIY
ATETLSKYDTVLKDEEPGDGLYGWTAPKQYKNQKEPERDLRYVGKILEGFSLASKPLSSK
KIYPPPQLPRDYRPVHYFRPVVAATAENAHVLQVLSESSGKAGQDVGTHSRHQLNASKRG
ELLGEMPIQGSATSVLEFLSQKDKERIKEVKQATDLKAAQAKARSLAQSASSSRAQASTP
DLGHSSWHLALGGGTVTTRANNFKPFAKDPEKQRRYEEFLVHMKKGQKDALERCLDPSMT
EWERSREREEFARAAQLYVSSNSTLSSRFTHAKEEEDSDQVEVPRDQENDVSDKQSAVKM
KMFGKLTRDTFEWHPDKLLCKRFNVPDPYPGSTLVGLPRVKRDKYSVFNFLTLPEPAPLP
TAPVPSEKAPQQRGSDKSRKPSRWDTSKQEKKEDSISEFLSQARSKVGPPKQESSALGSK
EEQAPEPRPDTTVDKAVDAQTDGEGSRPSMDLFKAIFASSSDEKSSSSEEEQDDSEDSQE
HTEEASLKGSQEAAAGETSVVLAAEPEPCEPATPFPIQKAQIDEREEFGPRLPPVFCPNS
RQKLEIPQKEKPKKSKERHKSKKEHRRKREKKKKHKKHKHKSKQKNKKSEKNSSSESTDS
SDSGSDDGGPAELSPQELLRRLKCLPLRRQ
NT seq 2793 nt   +upstreamnt  +downstreamnt
atggcggcgctggacagtgacagcgacgaggatctgatcagctatggaacgggcctggag
cctctggacgaaggtgaaagaccaaagaaacccattcctctacaagaccagactgtcaga
gatgagaaaggaaggtacaagcgcttccacggagcctttagtggtggtttctctgctggt
tacttcaataccgtcggctcaaaggaaggatggacaccctctacctttgtgtcttcaaga
cagaacagggcggacaaatctgctcttggacctgaagattttatggacgaagaggatctt
agtgaattcgggatagcacctaaagcaattgttaccacggatgattttgcttccaaaacc
aaagacagaatccgggagaaggccaggcagctggccgctgctgcagcccctattcccggc
gccacgctgcttgatgacctcatcacaccggcaaaattgtctgttggctttgaattgtta
agaaaaatgggttggaaggaagggcaaggagtcggccctcgggtgaagagaaaggcgcgc
cgacagaaaccagatcctggtgtgaagatctatggctgtgcattgccgcctggaggctct
gaagagtctgaggatgaagatgatgactacctgcctgacaatgtgacttttgctcctaaa
gacgtcatgcctgtggattttacacctaaagataatgtacatgggttggcctacaagggc
ctggacccccaccaagcattgtttggaatgccaggagaacacctgaatctttttggtggc
gcatctgaggggaccagccatcttcttggagatgttggactgagtaaaggaagaaaactg
ggcatttctggccaggcttttggtgtaggtgccctggaagaggaagatgatgacatctac
gccacagaaactctatccaagtatgacactgtgctgaaggacgaggagcctggagatggc
ctctatggctggacagctcccaaacaatacaaaaatcagaaagaacccgagagagatctt
cgatatgttggcaaaattttggaaggattttccttggcttctaaacctttatcttcaaag
aaaatttacccgccccctcagttgcccagagactaccgaccggtgcattatttcagacct
gtggtcgccgcaacagccgagaatgctcacgtacttcaggtgttatcagagtcatctggg
aaagcagggcaggacgtggggacacacagtaggcatcaactcaatgcctccaagcggggg
gagttgctaggagagatgcctattcaagggtcagctacttcagtgttggagtttctgtct
caaaaagacaaagagagaattaaagaagtgaagcaggcaactgacctgaaagccgcccaa
gccaaggccaggagtctggcccagagtgcttcaagcagcagagcgcaggcgtccacacca
gacctgggccacagctcatggcacctggccctgggcggagggacagtcaccaccagagcc
aacaacttcaagccttttgccaaagatccagaaaagcagagacgatacgaagagttctta
gtacacatgaagaagggtcagaaagatgctctggaacgatgcctggaccccagcatgacc
gagtgggagcgaagccgagagcgggaagagtttgcccgggcagcccagctctatgtgtcc
tccaactccaccctgtcctccaggttcactcacgccaaggaggaggaggattcagatcag
gtcgaagtccctcgggaccaagagaacgatgtcagtgacaagcagtcggctgtgaagatg
aagatgttcgggaagctcacccgagacacgtttgagtggcaccccgacaagcttctgtgt
aagaggtttaacgtcccggacccttatccaggctcaactttagttggcttacccagagtg
aagagggataaatactcagtcttcaacttcctgacgctcccagagcctgcccctctgccc
acagctccagtaccaagtgaaaaagccccgcagcaacggggttcagacaaatccaggaaa
ccatcacgatgggacacatccaaacaggagaagaaagaggattccattagcgagttttta
agtcaagctagatcaaaagttggacctccaaaacaagaatccagtgccttaggaagcaaa
gaggaacaggccccagagccacgcccagacacgactgtagacaaagctgtggatgcacag
acggacggggaaggtagccgcccttccatggatttattcaaagccatcttcgccagttcc
tctgatgaaaagtcctcatcttcggaggaggagcaagatgatagtgaggacagtcaagag
cacactgaggaggccagccttaaaggctctcaggaggctgctgctggggagacctctgtg
gtccttgctgctgagccggagccttgtgagcctgcaacccccttccccatccaaaaggca
cagattgacgaacgggaagagttcgggcctcggctgcctcctgtcttctgccccaactct
cgccagaaactcgagatacctcaaaaagagaaacccaagaagagcaaagaaagacacaag
agcaaaaaggaacacagaagaaagagagagaagaaaaagaaacataagaaacacaaacac
aaaagtaagcaaaagaataagaaatcggaaaaaaatagcagttctgagagtacagacagc
agtgacagtgggagcgatgacggagggccagcagagctgtcccctcaggagctgctgaga
agactgaagtgtctccccctaagaaggcaataa

DBGET integrated database retrieval system