KEGG   Mus musculus (mouse): 67475
Entry
67475             CDS       T01002                                 

Symbol
Ero1b, 1300013B24Rik, 1700065B09Rik, AI447560, Ero1lb, ero1-beta
Name
(RefSeq) endoplasmic reticulum oxidoreductase 1 beta
  KO
K10976  ERO1-like protein beta [EC:1.8.4.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    67475 (Ero1b)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     67475 (Ero1b)
SSDB
Motif
Pfam: ERO1
Other DBs
NCBI-GeneID: 67475
NCBI-ProteinID: NP_080460
MGI: 1914725
Ensembl: ENSMUSG00000057069
UniProt: Q8R2E9
Position
13; 13 A1
AA seq 467 aa
MSPGFRRAVTGQGAAAAVQLLVTLSFLSSLVKTQVTGVLDDCLCDIDSIDKFNTYKIFPK
IKKLQERDYFRYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGRSNKYSQA
ANSTKELDDCEQANKLGAINSTLSNESKEAFIDWARYDDSQDHFCELDDERSPAAQYVDL
LLNPERYTGYKGSSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGEDDGESFYTWLEGLC
LEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNIKEFRRRFDPVETKGEGPRRL
KNLYFLYLIELRALSKVAPYFERSIVDLYTGNVEDDADTKTLLLSIFQDTKSFPMHFDEK
SMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWGKLQTQGLGTALKILFSEKEI
QNLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRELQNFKALLQHRR
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgagtccggggttccgccgggccgttactgggcagggggcggcggccgcggtgcaactg
cttgtcaccctgagcttcctctcaagtctggtcaagactcaggtgactggagttctggat
gattgcttatgtgacattgacagcattgataaattcaacacctacaaaatctttcccaaa
ataaagaagttacaagaacgagactattttcgttattacaaggttaatctgaaacgacca
tgtcctttctgggcagaagatggccactgctcaataaaagactgtcatgtggagccctgt
ccagaaagtaaaattccagttggaattaaagccgggcgttcaaataagtactcgcaagca
gcaaacagcaccaaagaactggatgactgtgagcaggctaacaaactgggcgccatcaac
agcacgctaagtaacgaaagcaaagaagcgttcattgactgggcgagatatgatgattcg
caggaccacttttgtgaacttgatgatgagcggtctcctgctgcacagtatgtggacctg
ctgctgaacccggaacggtacactggctacaagggctcctcagcatggagggtgtggaac
agcatctatgaagaaaactgcttcaagcctcgatctgtttatcgtcctttaaatcctttg
gcgcccagcagaggggaagatgatggagaatcattctatacgtggctagaaggtttgtgt
cttgagaaaagagtcttctataagcttatatcaggactccatgccagcatcaatttacat
ctgtgtgcaaactaccttctggaagaaacctgggggaaacctagttggggaccaaacatc
aaggagtttagacgccgctttgaccctgtggaaacaaagggggaaggtccaaggaggcta
aagaacctgtactttttatacttgatagagctccgtgctttgtcaaaggtggccccttac
tttgagcgctcgattgttgatctctatactggcaatgtggaagatgatgccgacaccaag
acccttctgctcagcatctttcaggatacaaagtcctttcctatgcacttcgatgagaaa
tccatgtttgcaggtgacaaaaagggggccaagtcattaaaggaagaattccggttacat
ttcaagaacatctcccggatcatggactgtgttgggtgcgataaatgcagactgtggggg
aaactgcagactcagggtttaggaactgccttgaagatcctcttctctgaaaaggaaatc
caaaaccttccggagaacagcccatccaaaggcttccagctcactcggcaggaaatcgtt
gctcttttaaatgcttttggaagactttctacaagcataagagaattacagaactttaaa
gcgttgttgcagcacaggaggtaa

DBGET integrated database retrieval system