KEGG   Mus musculus (house mouse): 67477
Entry
67477             CDS       T01002                                 
Symbol
Abhd15, 1300007F04Rik
Name
(RefSeq) abhydrolase domain containing 15
  KO
K13707  abhydrolase domain-containing protein 15
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    67477 (Abhd15)
SSDB
Motif
Pfam: Hydrolase_4
Other DBs
NCBI-GeneID: 67477
NCBI-ProteinID: NP_080461
MGI: 1914727
Ensembl: ENSMUSG00000000686
UniProt: Q5F2F2 B6DQM2
Position
11:77405943..77411454
AA seq 459 aa
MPPWAAALALLLAALALLLLRPWKRAVGARTSVRDHEEQEVASGGPADQFSDRREALPGG
CSLICKPSALAQCLLRALRRSAALEPSPRSWLSGPHLQTFCHFILPVGPGPELAREYLQL
ADDGLVALDWVIGPCARGRRVTNPGSLPPVLLVIPNAWGRLTRNVLGLCLLALERGYYPV
IFHRRGHHGCPLVSPRLQPFGDPSDLKEAVTYIRFRHPAAPLFAVSEGSGSALLLSYLGE
CGSSSYVTGAACISPVLRCREWFEAGLPWPYERGFLLHQKISLSRYASALEDTVDTGKLF
RSGSLREFEETLFCHTKSCPISWDTYWDLNDPLRDVDEAAVPVLCICSADDPVCGPPEHT
LPAELFHSNPYFFLLLSHHGGHCGFLRPEPLPAWSHEVILESFRALTEFFRMEERMKGLS
RRRTSFLGGRRRWGGLQKREVSPSSNLEEIFNWKRSYTR
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgcctccgtgggcggccgctctagcgctgctactggcggcgctcgccttgctcctcctg
cgaccctggaagcgcgctgtcggagcgcgaacctcagtccgggaccacgaggagcaggag
gtggcgagcggaggccccgcggatcagttcagcgaccggcgcgaagcgctccccggaggc
tgcagcctcatttgcaagccgtcggcgctggcccagtgcctgctgcgcgctctgcgacgc
tcggcggcgctggaacccagcccccgctcctggctgtcgggaccccacctgcaaaccttc
tgccacttcatcctgccagtcgggcccgggcctgagctagcccgtgagtacctgcagctg
gcagatgatgggctggtggctctggattgggtcataggaccttgtgccaggggccgccgg
gtcaccaaccctgggagcctccctccagtgctgttggtaatccccaatgcatggggacgc
ctcactcgcaatgtactggggctctgcctgctcgccctggagcgcggctactacccggtc
atcttccatcgccgcggccaccacggttgcccgctagtcagccccagactacagcctttc
ggggacccgtccgacctcaaggaggcggtgacttacattcgcttccgacacccggcggcc
cccctgttcgcggtgagcgagggttcagggtccgcgctgctgctgtcctacttgggggag
tgtggctcctccagctatgtgactggcgccgcctgcatctcgccagtgctacgctgtcgc
gagtggttcgaggctggcttgccttggccctatgaacgtgggttcttgctgcaccagaaa
atctctctcagcaggtatgcctccgccctggaggacacagtggacaccggcaagctcttc
aggagtggctccctgcgagagtttgaggagaccctgttctgtcacaccaagagttgcccc
atcagctgggatacctactgggatctcaacgacccactccgggatgtggatgaggctgcg
gtacccgtgctgtgcatctgcagtgctgatgacccggtgtgtggacccccagagcacact
ctgcctgcggaactcttccacagcaacccgtacttcttcctgctgctcagtcaccatgga
ggccactgtggcttcctgcgccctgaacccttgccagcatggagccacgaggtcatcttg
gagtccttcagggccctgactgaattcttccgaatggaagagagaatgaaagggctgagc
aggcgcaggacttcatttttagggggccggcgtcgctggggaggcctgcagaagcgagag
gtttccccttcttccaatctggaggagattttcaactggaagcgttcatacaccaggtga

DBGET integrated database retrieval system