KEGG   Mus musculus (mouse): 67480Help
Entry
67480             CDS       T01002                                 

Gene name
Cwc25, 1300013D05Rik, AA473636, Ccdc49, R75228
Definition
(RefSeq) CWC25 spliceosome-associated protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: CWC25 Cir_N SPC25
Motif
Other DBs
NCBI-GeneID: 67480
NCBI-ProteinID: NP_080462
MGI: 1914730
Ensembl: ENSMUSG00000018541
Vega: OTTMUSG00000002750
UniProt: Q9DBF7
Position
11; 11 D
AA seq 416 aa AA seqDB search
MGGGDLNLKKSWHPQTLRNVEKVWKAEQKHEAERKKIEELQRELREERAREEMQRYAEDV
GAVKKKEEKLDWMYQGPGGMVNRDEYLLGRPIDKYVFEKMEEREAGCSSETGLLPGSIFA
PSGANSLLDMASKIREDPLFIIRKKEEEKKREVLNNPVKMKKIKELLQMSLEKKEKKKKK
EKKKKHRKHKHRSSSSGGSSSEDEQSQARSQKKMANSFPVLSKVPGYGLQVRDSDRNRGL
QGSLGEQRAIKNNSRSRSSSPPRHASKKSTKEERPRDRRSRSPSRRSRSPRPSKPHTSKV
NRKERDSPSPKKEAYQRRHASGYTRKLSAEELERKRQEMMENAKWREEERLNTLKRHARE
DEREHRLERLDSRSGKFLHRMKLESASTSSLEDRVKRNIHSLQRTSVALEKNFMRR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcggagacctgaacctgaagaagagctggcacccgcagacccttcgcaatgtg
gagaaagtgtggaaggcggagcagaagcatgaagcggagaggaagaagattgaggagttg
cagcgagagctccgagaggagagagcgcgggaggagatgcagcgctacgctgaggatgtt
ggggctgtcaagaaaaaagaagaaaagttggattggatgtaccaaggtccgggtggcatg
gtgaaccgtgatgagtacttgctggggcgccccattgacaagtatgtttttgagaagatg
gaggagagggaagctggctgctcttctgagacaggactcctcccaggctcaatctttgcc
ccgtcgggcgccaattcccttcttgacatggccagcaaaatccgggaagaccctctcttc
atcataaggaagaaagaggaggagaaaaaaagagaagtgctgaacaatcctgtgaaaatg
aagaaaatcaaagagctgttgcaaatgagccttgagaaaaaggagaagaagaagaagaag
gagaagaagaagaagcacaggaagcacaaacacagaagctccagcagcggtggctccagc
agcgaggatgagcagagccaggcccggtctcaaaagaagatggcaaattcctttcctgtt
ttgtccaaagtccctggatatggcttacaggtgagggactctgaccggaaccgggggctg
cagggttctctgggtgaacagagggcgataaagaacaattcccggtcaagaagctcctca
ccccccaggcatgccagcaagaagagcaccaaggaagagaggccccgggacaggaggtct
cgatcccccagcagaaggtcccggtccccaaggcccagcaaaccgcatacctctaaggta
aacaggaaagagagagacagcccatcacctaagaaggaggcctaccagaggcggcatgct
tctgggtacaccagaaaactctcagcagaggaactagagcggaaacggcaggagatgatg
gaaaatgccaagtggagggaggaggagaggctcaacaccctcaagaggcacgccagggag
gacgagcgggagcacaggctggagaggttggactctcggtccggcaagttcctccaccgc
atgaagctggagagtgcgtcgacctcctccctggaggaccgcgtgaagcgcaacatccat
tccctacagcggacgtcggtggccctggagaagaacttcatgaggagatga

DBGET integrated database retrieval system