KEGG   Mus musculus (mouse): 67484
Entry
67484             CDS       T01002                                 

Gene name
Eepd1, 2310005P05Rik, AI481005
Definition
(RefSeq) endonuclease/exonuclease/phosphatase family domain containing 1
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: HHH_3 HHH HHH_6 T2SSK HHH_5 HHH_2 Exo_endo_phos PsbU
Other DBs
NCBI-GeneID: 67484
NCBI-ProteinID: NP_080465
MGI: 1914734
Ensembl: ENSMUSG00000036611
Vega: OTTMUSG00000027404
UniProt: Q3TGW2
Position
9; 9 A4
AA seq 569 aa
MGSTLGCHRSIPRDPSDLSHNRKFSAACNFSNILVNQERLNINTATEEELMTLPGVTRAV
ARSIVEYREYIGGFKKVEDLALVSGVGATKLEQVKFEICVSSKGNSAQHSPSSLRRDLLA
EQQPHHLTTTVPLTPRVNINTATLAQLMSVRGLSEKMALSIVDYRREHGPFRSVEDLVRM
DGINAAFLDRIRHQVFAERSRPPSTHTNGGLTFTAKPHPSPTSLSLQSEDLDLPPGGPTQ
IISMRPSVEAFGGMRDGRPVFRLATWNLQGCSVEKANNPGVREVVCMTLLENSIKLLAVQ
ELLDKEALEKFCTELNQPILPNIRKWKGSRGCWRSIVAEKPSNQLQKGPCYSGFLWDTAA
NVELRDIPGRESSPSNGHAKAVGPSPFLARFKVGSNDLTLVNLQLTALALPGAENSSKNH
SDGHRLLNFALTLQETLKGEKDVVILGDFGQGPDSNDYDILRREKFHHLVPAHTFTNIST
RNPQGSKSVDNIWISKSLKKVFTGHWAVVREGLTNPWIPDNWSWGGVASEHCPVLAELYM
EKDWSKKEVPRNGNGVTLEPSEANIKHER
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggggagcacactgggctgccatcgctctatccccagagatccctcggacctgtcacat
aaccgcaagttcagcgctgcctgcaacttcagcaacatcctggtgaatcaggagcggcta
aatatcaacactgccactgaggaggaactgatgactctgcctggggtgacacgtgcagtg
gcccgaagcatcgtggaataccgagaatatatcggcggcttcaaaaaggtggaagatctg
gcacttgtcagtggtgtaggggccaccaaactggaacaggtcaagtttgagatctgtgtg
agcagcaagggtaactctgcacagcactctcccagttccctgaggcgggatcttctggct
gagcagcagcctcatcacctgaccaccactgtgcccctcactcctcgagtcaatatcaac
acagccacccttgctcagctcatgagtgtccggggcctcagcgagaagatggccctcagc
atcgtggactaccgcagggaacacggtccttttcgaagtgttgaggacttggtgagaatg
gatggaatcaatgcagccttcctggacagaataagacaccaggtgttcgcagagaggtcc
aggcccccatcaacccacaccaatgggggtcttaccttcactgccaagcctcatcccagt
cccacatctctgagcctgcagagtgaggacttggacctgccaccaggggggcccacgcag
attatctccatgaggccctcggtggaggcctttggaggtatgagggatgggcgacctgtg
tttaggttggccacgtggaacttacagggctgctctgtggagaaggccaataacccgggg
gttcgagaggtggtgtgcatgacgcttctggaaaacagcatcaaacttctagctgtgcaa
gagctgcttgacaaagaggccctggaaaagttctgtacagagctgaaccagccgatcctg
cccaacatccgcaagtggaaggggtcccgaggatgctggaggtccattgttgctgagaag
ccttccaatcagctccagaagggcccctgctactctggattcctatgggacacagcagcc
aacgtggagctgagagacatccccgggcgggagagctcacccagcaacggtcatgctaag
gctgtgggccccagccctttcctcgccagattcaaggtgggaagtaatgacttaaccctg
gttaacctccagctgacagccctggccctcccaggagctgagaattcaagcaagaatcac
agtgatggccaccgattattgaactttgcactaaccctccaggaaaccctgaaaggagaa
aaggatgttgttattttaggggattttggccaagggccagatagcaatgactacgatatc
ctaaggagagaaaaatttcaccacctagtcccggctcacactttcaccaacatcagcacc
aggaatcctcaaggctccaagtctgtggacaacatctggatcagcaaaagcttaaagaaa
gtgttcacaggtcactgggctgttgtgagagaagggctcacaaacccttggattccagat
aactggtcctggggtggagtcgcttctgaacattgccctgtgcttgctgaattgtacatg
gaaaaggactggagcaagaaggaagtccccaggaatggcaatggagtcaccttagagcca
agtgaagccaacattaaacatgagcgatga

DBGET integrated database retrieval system