KEGG   Mus musculus (mouse): 67486
Entry
67486             CDS       T01002                                 

Gene name
Polr3g, 2310047G20Rik, AV275904, RPC, RPC32, RPC7
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide G
  KO
K03024  DNA-directed RNA polymerase III subunit RPC7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    67486 (Polr3g)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    67486 (Polr3g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    67486 (Polr3g)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     67486 (Polr3g)
SSDB
Motif
Pfam: RNA_pol_3_Rpc31 BUD22
Other DBs
NCBI-GeneID: 67486
NCBI-ProteinID: NP_001074645
MGI: 1914736
Ensembl: ENSMUSG00000035834
Vega: OTTMUSG00000035047
UniProt: Q6NXY9
Position
13; 13 C3
AA seq 223 aa
MAGNKGRGRAAYTFNIEAVGFSRGEKLPDVVLKPPPLFPDTDYKPVPLKTGEDEDYMLAL
KQELRETVKRLPYFIEPPEEKQDDIERYSKRYMKVYKEEWVPDWRRLPREMMPRKKCKKG
DPKSKPSKAAAKATSLINSADVLKTIEELEKRGEGERSDEENEEKEGSKEKDKDDEEDGE
EDAEQEDYDEEEQEEENDYINSYFDNGDDFGVDSDDNMDEATY
NT seq 672 nt   +upstreamnt  +downstreamnt
atggctggcaataaaggaagagggcgtgctgcctacacctttaatatcgaagctgttgga
ttcagcagaggggagaagttacctgatgttgtgttgaagcctccacccctgtttcctgat
acagactacaagccggtgcccctgaaaacgggagaagatgaggattacatgctggccttg
aagcaggagttgagggaaacagtgaaacgattgccgtactttattgaaccacccgaagaa
aaacaagatgatattgaaaggtatagcaaacgatacatgaaggtctataaagaagaatgg
gtaccagattggagaagacttccaagagagatgatgccaaggaaaaaatgcaaaaaaggg
gatccaaaatccaagccgagcaaagctgcagccaaggctacatcactcattaattctgca
gatgtgttgaaaacgattgaggaactggaaaagagaggcgagggtgaaagatcggatgaa
gaaaacgaagagaaagaagggagcaaagagaaagataaagatgatgaggaggatggcgag
gaagatgcagaacaggaggactacgatgaagaggaacaagaagaggagaatgactacatt
aactcctacttcgacaacggcgatgattttggtgtagacagcgacgacaacatggatgaa
gccacctactag

DBGET integrated database retrieval system