KEGG   Mus musculus (mouse): 67487Help
Entry
67487             CDS       T01002                                 

Gene name
Dhx40, 2410016C14Rik, ARG147, DDX40, PAD
Definition
(RefSeq) DEAH (Asp-Glu-Ala-His) box polypeptide 40
  KO
K18711  ATP-dependent RNA helicase DHX40 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    67487 (Dhx40)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     67487 (Dhx40)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA processing factors
   Other processing factors
    67487 (Dhx40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C DEAD T2SSE AAA_22 DUF2075 AAA_30 DUF4685 AAA_19 Flavi_DEAD RuvC_1 Helicase_RecD PhoH RbsD_FucU
Motif
Other DBs
NCBI-GeneID: 67487
NCBI-ProteinID: NP_080467
MGI: 1914737
Ensembl: ENSMUSG00000018425
Vega: OTTMUSG00000001202
UniProt: Q6PE54
Position
11; 11 C
AA seq 779 aa AA seqDB search
MSRFPAVAGRAPRRQEEGERPIELQEERPSAVRIADREEKGCTSQEGGTTPTFPIQKQRK
KLIQAVRDNSFLIVTGNTGSGKTTQLPKYLYEAGFSQHGMIGVTQPRKVAAISVAQRVAE
EMKCTLGSKVGYQVRFDDCSSKETAIKYMTDGCLLKHILGDPNLSKFSVIILDEAHERTL
TTDILFGLLKKLFQDKSPNRKEHLKVVVMSATMELAKLSAFFGNCPIFDIPGRLYPVREK
FCNLIGPRDRENTAYIQAIVKVTMDIHLNEMAGDILVFLTGQFEIEKSCELLFQMAESVD
YDYDVQDTTLDGLLILPCYGSMTTDQQRRIFLPPPPGIRKCVISTNISATSLTIDGIRYV
VDGGFVKQLNHNPRLGLDILEVVPISKSEALQRSGRAGRTASGKCFRIYSKEFWSQCMPD
HVIPEIKRTSLTSVVLTLKCLAIHDVIRFPYLDPPNERLILEALKQLYQCDAIDRSGHVT
RLGLSMVEFPLPPHLTCAVIRAASLDCEDLLLPIAAMLSVENVFIRPVDPEYQKEAEQRH
RELAAKAGGFNDFATLAVIFEQCKSSGAPASWCQKHWIHWRCLFSAFRVEAQLRELIRKL
KQQSDFPRETFEGPKHEVLRRCLCAGYFKNVARRSVGRTFCTMDGRGSPVHIHPSSALHE
QETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHELNAHDLSSVARREMREDAR
RKWTNKENVKQLKDGISKEVLKKMQRRNDDKSISDARARFLERKQQRIQDHSDTLKETG
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggtttcccgccgtcgcgggcagggcgccaaggcggcaggaggaaggcgagcgg
ccaatagagctccaggaagagcggccgtcagctgttcgcatcgctgacagagaagagaaa
ggatgcacatcacaggagggaggaacaactccaacgtttcctattcagaaacaaagaaaa
aagctcattcaagctgtgagggacaactcgttcctcatcgttactggaaatacaggaagt
ggtaaaacaactcaactccctaaatacctttatgaagcagggttttcacaacatggtatg
attggtgtgactcagccacgaaaagtagccgccatatcagttgctcagagggttgctgag
gaaatgaaatgcactttgggatctaaagtaggataccaagttcgttttgatgattgcagc
tccaaggaaacagcaatcaaatacatgactgatggatgtttactcaaacatattttggga
gatccaaatcttagcaaattcagtgtcattattttggatgaagcccatgaaagaacttta
actacagatatcttatttggtttactgaagaagctgtttcaggataagtctcctaacagg
aaagagcatttaaaggtggtagtgatgtcagcaactatggaactagccaagctctctgca
ttctttggaaattgccccatatttgatatacctggaagactctatccagtcagagagaaa
ttctgcaatttgatcggaccacgagacagagaaaatactgcatatattcaagcgattgtg
aaagtgaccatggatattcatttgaatgaaatggctggagacatcttagtttttctgact
ggccagtttgagatagagaagagttgcgagctgctctttcagatggcggagtctgttgac
tatgattatgatgtacaagataccacgctagatggcttgttgattctgccatgttacggc
tctatgacaacagatcaacagaggagaatatttttgccacctcctcctggaattagaaaa
tgtgttatatccaccaatatttctgcaacatctttgacaatagatgggatcagatatgtg
gtggatggaggctttgtgaagcaattaaatcacaacccaagattagggctggacatcctg
gaggtggttcctatttcaaaaagtgaagcattacaacgcagtggccgtgcgggcaggacc
gcctcaggaaagtgctttaggatttacagtaaagagttttggagccagtgtatgcctgac
catgtgatcccagagattaagagaactagtttgacatctgtagttctgacattaaagtgc
cttgccatacatgatgtcataaggtttccatatttggatccacctaatgagagacttatt
ttggaagcacttaaacaactttatcagtgtgatgctattgacaggagtggccatgtgaca
agattgggattatccatggtggagttccctctccccccacatctgacgtgtgcagtgatc
agggctgcttctcttgactgtgaagatttgctgcttccaatagcagcaatgctatctgtg
gaaaatgtcttcatcagacctgttgatccagagtaccagaaggaagcagaacagagacat
cgggaattggcagcgaaagctggaggatttaatgactttgcaactttagctgtcattttt
gaacagtgcaaatcaagtggagctccggcttcgtggtgccagaagcactggattcactgg
cggtgcttattctctgcatttcgtgtggaagctcaacttcgggaactgatcaggaaacta
aagcagcaaagtgatttcccaagagagacttttgaaggccctaaacatgaagtactacga
agatgtctttgtgcaggctacttcaaaaatgttgctcgaagatctgttggcagaacattt
tgcacaatggatgggcgtggaagtccagttcatatccatccttcctcagcacttcatgaa
caggaaaccaaacttgaatggataatttttcatgaagtattagttaccaccaaagtctat
gcaagaattgtgtgcccaatccgttatgaatgggtgagagacttactacccaagttgcat
gaacttaatgcgcatgatttgagcagtgtggctagacgtgaaatgagagaagatgcaaga
agaaaatggacaaataaggaaaatgtgaaacagctaaaggatggaatatcaaaagaagtt
ctaaagaaaatgcaaagaagaaatgatgacaaatccatatcagatgcacgggctcgcttc
cttgagagaaagcaacagagaatccaggaccacagtgacacattaaaggaaactggctaa

DBGET integrated database retrieval system