KEGG   Mus musculus (mouse): 67498Help
Entry
67498             CDS       T01002                                 

Gene name
Kcnv1, 2700023A03Rik, vibe
Definition
(RefSeq) potassium channel, subfamily V, member 1
  KO
K04934  potassium channel subfamily V member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    67498 (Kcnv1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   67498 (Kcnv1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 BTB_3
Motif
Other DBs
NCBI-GeneID: 67498
NCBI-ProteinID: NP_080476
MGI: 1914748
Ensembl: ENSMUSG00000022342
UniProt: Q8BZN2
Position
15; 15 B3.3
AA seq 503 aa AA seqDB search
MDLSPRNRPLLDSSSLDSGSLTSLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQAL
SCFPHTRLGKLAVVVASYRRLGALAAAPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYY
RTGRLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTDDQESQ
HESEQDFSKGPCPTVRQKLWDILEKPGSSTAARIFGVISIIFVAVSIVNMALMSAELSWL
NLQLLEILEYVCISWFTGEFVLRFLCVKDRCHFLRKVPNIIDLLAILPFYITLLVESLSG
SHTTQELENVGRLVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGI
SIFSTIEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGI
LVLALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIM
EMLRLKGRERASTRSSGGDDFWF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctgtcaccccgcaaccggccgctactggactcgtcgtcgctggacagcggttct
ctgacctcactggactccagtgtcttctgtagcgagggcgaaggggaacccttggctctg
ggggactgctttacagtcaacgtgggcggtagccgcttcgtgctctcgcagcaagctctg
tcctgcttcccgcacacgcgcctgggcaaactggccgtagtggtggcctcctaccgccgc
ctgggtgccctggctgccgcccccagccccctggagctttgcgatgatgcgaatccggtg
gacaacgagtacttctttgatcgcagctctcaggcgttccgttatgtcctgcactactat
cgcactggtcgcctgcatgtcatggagcagctctgtgcgctctcctttcttcaggagatc
cagtactggggcatagatgaactcagcattgactcctgctgcagggacagatacttcaga
agaaaggagctgagtgaaactcttgactttaagaaggacacagatgaccaggaaagtcaa
catgagagtgaacaggacttctcaaaaggaccttgtcccactgtccgacaaaagctctgg
gatattctggagaaacctggatcttccacagcagcccggatctttggagtaatctccatc
atttttgtggcagtgtccatcgtcaacatggccctgatgtcagctgagcttagctggctc
aacctacagctgctggagatcttggagtatgtgtgcatcagctggttcaccggggagttc
gttctgcgcttcctatgtgtgaaagacaggtgccacttcctgaggaaggttccaaacatc
atagacctccttgccatcttgcccttctatataactcttctggtggaaagcctgagcggc
agccacaccacacaagagctggaaaatgtgggacgtctggtccaggtcttgaggctcctc
agagctctgcgcatgctgaaactgggaaggcattctacaggattgcgctcacttgggatg
acaatcactcagtgctatgaagaagttggcctactgctcctgtttctatctgtggggatt
tctatattttcaacaatagaatactttgcagagcaaagcattcctgatacaaccttcaca
agtgttccttgtgcatggtggtgggccacaacatccatgactacagtaggatatggggac
attagaccagacaccaccacaggcaaaatcgtggccttcatgtgtattctgtcaggaatc
cttgtcttggccttgcctattgccattattaatgatcgattctctgcttgctacttcacc
ttgaaactcaaggaagcagctgtgagacagcgtgaagctctcaagaaacttaccaagaat
atagccactgactcatatattagtgttaacttgagggatgtctatgcccggagcataatg
gagatgcttcgattaaagggcagggagagagcaagtactagaagcagtggtggagatgat
ttctggttttaa

DBGET integrated database retrieval system