KEGG   Mus musculus (mouse): 67500Help
Entry
67500             CDS       T01002                                 

Gene name
Ccar1, 2610511G16Rik, 9430036H15Rik, Carp1
Definition
(RefSeq) cell division cycle and apoptosis regulator 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DBC1 S1-like SAP Tautomerase_2
Motif
Other DBs
NCBI-GeneID: 67500
NCBI-ProteinID: NP_080477
MGI: 1914750
Ensembl: ENSMUSG00000020074
UniProt: Q8CH18
Position
10; 10 B4
AA seq 1146 aa AA seqDB search
MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPAN
YQLTQTAALQQQAAAVLQQQYSQPQQALYSVQQQLQQPQQTILTQPAVALPTSLSLSTPQ
PAAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLGAVKGKTPQVG
DRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPTAVIQPIVPQTTFGVQAQPQ
PQSLLQAQISAASITPLLQTQPQPLLQQPQQKAGLLQPPVRIVSQPQPARRLDPPSRFSG
RNDRGDQVPNRKDDRSRERDRERRRSRERSPQRKRSRERSPRRERERSPRRVRRVVPRYT
VQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFYVMH
REVESLEKNMAVLDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQDLRDGFQHPAR
LVKFLVGMKGKDEAMAIGGHWSPSLDGPNPEKDPSVLIKTAIRCCKALTGIDLSVCTQWY
RFAEIRYHRPEETHKGRTVPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEKLQG
ERKKADGEQDEEEKDDGEVKEIATPTHWSKLDPKAMKVNDLRKELESRALSSKGLKSQLI
ARLTKQLKIEEQKEEQKELEKSEKEEEDEDDKKSEDDKEEEERKRQEEVERQRQERRYIL
PDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFG
VRIYKSLLSLPEKEDKKDKEKKSKKEERKDKKEEREDDIDEPKPKRRKSGDDKDKKEDRD
ERKKEEKRKDDSKDDDETEEDNNQDEYDPMEAEEAEDEDDDREEEEVKRDDKRDVSRYCK
DRPAKDKEKEKPQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKL
LNKVVLRESCFYRKLTDTSKDDENHEESEALQEDMLGNRLLLPTPTIKQESKDGEENVGL
IVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDGKTILNLENSNKSLSGELR
EVKKDLGQLQENLEVSENMNLQFENQLNKTLRNLSTVMDDIHTVLKKDNVKSEDRDEKSK
ENGSGV
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtttggaggacagaagaatccaccatgggctactcagtttacagccactgcg
gtctcacaaccagctgcactaggtgttcagcagccatcacttctgggagcatctcctacc
atttatacccagcagactgcattggcggcggcaggccttaccacacaaacgccagcaaac
tatcagttaacacaaactgcggcactgcagcaacaagctgcagctgtattacagcagcaa
tattcacaacctcagcaggccttgtatagtgtgcagcagcagttgcaacaacctcagcag
accattttaacacagccagctgttgcattgcccacaagccttagcctgtcgactcctcag
cctgcagcacagattactgtatcatatccaacaccaaggtccagtcaacagcaaactcaa
cctcagaagcagcgtgttttcacaggagtggttacaaagctacatgatacatttggattt
gtggatgaagatgtattctttcagcttggtgctgttaaagggaaaaccccccaagttggt
gatagagtattggttgaagcaacttataatcctaatatgccttttaaatggaatgcacaa
agaattcaaacactaccaaatcagaatcagtctcaaacgcaacctttactgaagactccg
actgctgttattcagccgattgtgccacagacaacgtttggtgttcaggcacagccccaa
ccccagtcattattgcaggcccagatctcagctgcctctattacaccactattgcagacg
cagccacagcccttattacagcagccacagcagaaagctggtttattgcagcctcctgtc
cgaatagtgtcacagccacaacctgcgcggagattagatccaccatcacgattttcagga
agaaacgacagaggggatcaagtacctaatagaaaagatgaccgaagtcgtgaaagggac
agagaaagacgcagatctagagaaagatcacctcagaggaaacgttcccgggagaggtca
ccccggagagaaagagagcgctcccctcggagagtccgtcgtgtcgttccacggtacaca
gtgcagttttcaaagttttctttagattgtcccagttgtgacatgatggaactaaggcgc
cgttatcagaacttatatattcctagtgacttttttgatgctcagtttacatgggtggat
gctttccctttgtcaagaccatttcaactgggaaattactgcaatttttatgtgatgcac
cgagaagtagagtccttagaaaaaaatatggctgttcttgatccacctgatgctgaccac
ctgtacagtgcaaaggtaatgctgatggctagccctagtatggaagacttgtatcataag
tcatgtgctcttgctgaagacccacaagaccttcgtgatggttttcagcatcctgctaga
cttgttaagtttctagtgggaatgaaaggcaaggatgaagccatggccattggaggccac
tggtctccttcgctggatggaccaaacccagaaaaagatccctctgtgttgattaaaact
gccattcgttgttgtaaggctctgacaggcattgatctaagtgtatgcacacagtggtac
cgttttgcagagattcgctaccatcgccctgaggagacccacaaggggcgtacagttcca
gctcatgtggagacagtggttttatttttcccggatgtttggcattgccttcccacccgc
tcagagtgggaaaccctctcccgaggatacaagcagcagctggtcgagaagcttcagggt
gaacgcaagaaggctgatggagaacaggatgaagaagagaaggatgatggtgaagttaaa
gagatcgccactcctacccattggtctaagcttgatccaaaggcaatgaaggtaaatgat
ctccgaaaagaattagaaagtcgagctctcagttccaaaggactaaaatcgcagttaata
gctcgcctaacaaagcagcttaaaatagaagaacaaaaagaagagcagaaggaattagag
aagtctgaaaaggaagaggaagatgaggatgataagaagtctgaggatgataaagaggaa
gaagaaagaaaacgtcaagaagaagtggaacgacagcgtcaagaaagaagatacattttg
cctgatgaacctgccataattgtgcatccgaactgggctgcaaaaagtggcaagtttgat
tgcagcatcatgtctttgagtgtccttttggattacagattggaagataataaagaacat
tcttttgaggtttcactgtttgcagaacttttcaatgaaatgcttcaaagagactttggg
gttagaatatacaaatcattactctctcttcctgagaaagaggacaaaaaagataaggag
aagaaaagcaaaaaagaagagagaaaagataaaaaagaagaaagagaagatgatattgat
gaaccaaaaccaaaacggagaaaatcaggcgacgataaagacaaaaaagaagacagagat
gagagaaagaaagaagaaaaaagaaaagatgattctaaagatgatgatgaaactgaagaa
gataacaatcaagatgagtatgacccaatggaggcagaggaagctgaggatgaagatgac
gatagggaggaggaggaagtaaaacgagatgacaaaagggatgtcagccggtactgcaag
gacagacctgcgaaagataaggaaaaagagaagcctcaaatggtcacagttaacagggat
ctgctaatggcctttgtttattttgatcaaagtcattgcggttaccttcttgaaaaggat
ttggaagaaatactatatactcttggactgcatctttctcgggctcaggtaaagaaactt
cttaataaagtagtactccgagaatcgtgcttttatcggaaattaacagacacctcgaaa
gatgatgagaaccatgaagagtcagaggcactgcaggaagacatgctaggaaacagatta
ttacttccaacaccaacaataaaacaggaatcaaaagatggagaggaaaatgtagggctt
attgtgtacaatggtgcaatggtggatgttgggagtctcctacaaaaactggaaaagagt
gagaaagtaagagctgaggtggaacagaagctccagttactagaggagaaaacagatgaa
gatgggaaaactatattaaacttggagaactctaacaaaagcctctctggtgaacttaga
gaggtcaaaaaagaccttggtcaattacaagaaaacctggaggtttcagaaaacatgaat
ttgcaatttgaaaaccaattgaataaaacactcagaaacttatctacagttatggatgat
atccacactgtcctcaaaaaggataatgtaaagagtgaagacagagatgagaaatccaag
gagaacggctcaggtgtatga

DBGET integrated database retrieval system