KEGG   Mus musculus (mouse): 67509
Entry
67509             CDS       T01002                                 

Symbol
Saysd1, 1810063B07Rik, 4930488P03Rik
Name
(RefSeq) SAYSVFN motif domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SAYSvFN
Other DBs
NCBI-GeneID: 67509
NCBI-ProteinID: NP_080485
MGI: 1914759
Ensembl: ENSMUSG00000045107
UniProt: Q8K190
Position
14; 14 A3
AA seq 188 aa
MEQRLAEFREARKRASLVAQPSTSSQSVQTSGAKAEPAAATPKTATGWLTRFLKRKANPA
IAQAQPNQPQEAGQQLPESTAVPLPSSCRQSFLTNITFLKVLLWLVLLGLFVELEFGLAY
FVLSMFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLEQELQLRPPQGSRT
SPSCSSYP
NT seq 567 nt   +upstreamnt  +downstreamnt
atggaacagcggttagccgagttccgggaggcccgcaaacgggccagtctggtagcccag
ccttccacgtccagtcagagcgtacagacctcgggagcgaaggcggagccagcggcggcg
accccaaagacagccacgggctggctgacacgcttcctgaaacggaaagccaaccccgcc
atcgctcaggctcagcccaaccagcctcaggaagcaggccagcagctccctgagagcaca
gcagtccctctgccttcctcctgccgccagtctttcctgactaacatcaccttcttgaag
gttctcctctggttggtcctgctgggactgtttgtggaactggaatttggtctggcttat
tttgtcctgtccatgttctattggatgtatgtagggactcggggtcccgaggagaagaaa
gaaggggagaagagcgcctactctgtgttcaacccgggctgtgaagccatccagggcacg
ctgactgctgagcagctggagcaagagttacagctcagaccccctcagggaagtaggacc
agccccagctgttcctcctatccttga

DBGET integrated database retrieval system