KEGG   Mus musculus (mouse): 67513Help
Entry
67513             CDS       T01002                                 

Gene name
Faap20, 2610002J02Rik
Definition
(RefSeq) Fanconi anemia core complex associated protein 20
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: FANCA_interact UBZ_FAAP20
Motif
Other DBs
NCBI-GeneID: 67513
NCBI-ProteinID: NP_001177374
MGI: 1914763
Ensembl: ENSMUSG00000073684
Vega: OTTMUSG00000010597
UniProt: Q3UN58
Position
4; 4 E2
AA seq 186 aa AA seqDB search
MEEERRLRGRLSRRRPPAGGGPPNCRPWFLSEGSKSEPWAALLRSTVSGTADWTPNRQPL
PPLPAFPSQESLPDPESTVPPEAFTVGSKTFSWTPLPPALRGSGSSRHLFCEPEGSLGSP
TPSLKGCPALNSGRTPSAQECVPVQSPLALLSCPLCQKAFDPKLTQLDVDSHLAQCLAEC
TEDVVW
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggagcggagactgcgggggaggctgagccgtcggaggccgcccgcggggggc
gggccccctaactgccgcccttggtttctctcggagggaagtaagagtgagccctgggct
gctctgttgcgcagcaccgtgagcgggaccgcggattggaccccgaaccgtcagccatta
ccaccgctgcctgcttttcccagccaggagtctctacctgacccagagtccactgtgcct
cctgaggccttcactgtgggatccaagactttctcctggacgcctttgccacctgccctt
cgtggctctggaagctcccgccacctgttctgtgaacctgaaggctccctggggtcacct
actccatccctgaaaggatgccctgcactaaattctggtcgaactcccagcgcccaggag
tgtgtgcctgtgcagagtccacttgcgttgctgagttgcccgttgtgccagaaggcgttt
gacccgaagctgacccagctagatgtggatagccaccttgctcagtgcttggctgagtgc
accgaagatgtggtgtggtga

DBGET integrated database retrieval system