KEGG   Mus musculus (house mouse): 67516
Entry
67516             CDS       T01002                                 
Symbol
Kctd4, 2210017A09Rik, AU017169
Name
(RefSeq) potassium channel tetramerisation domain containing 4
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: KCTD4_C BTB_2 BTB_3
Other DBs
NCBI-GeneID: 67516
NCBI-ProteinID: NP_080490
MGI: 1914766
Ensembl: ENSMUSG00000046523
UniProt: Q9D7X1
Position
14:76192443..76202657
AA seq 259 aa
MERKIIRREKEREYEGRHNSVEDAEQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLE
GIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLK
GLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRL
DGFPEEFSVSSNIIQFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLT
SLDCSKGSIVHSDALHFIK
NT seq 780 nt   +upstreamnt  +downstreamnt
atggagcgtaaaataatcagaagagaaaaggaaagggagtacgaagggaggcacaacagc
gtggaagatgccgagcaaggcaagaactgcaaatccacgctgatgaccctcaacgttggt
ggatatttatatattactcaaaagcagacactgaccaagtacccagacactttccttgaa
ggtatcgtaaatgggaaaatcctctgtccattcgatgctgatggccattacttcatagac
agggacgggcttctcttcaggcatgtcctaaacttcctacgaaatggagaacttctacta
cccgaaggatttcgagaaaatcaacttcttgctcaagaagcagaattcttccagctcaag
gggctggcagaggaggtgaaatccaggtgggaaaaagaacagctgaccccccgagagact
actttcttggaaataacagataatcacgatcgctcacaaggactgagaatcttctgtaat
gctcctgatttcatatcaaaaataaaatctcgcattgttctggtatccaaaagcaggctg
gatgggtttccagaggagttctctgtgtcgtcaaatatcattcaatttaaatacttcatc
aagtctgagaacggcactcgacttgtactaaaggaagacaacacctttgtctgcaccttg
gaaactcttaagtttgaggccataatgatggctttaaaatgtgggtttagactgctgact
agcctggactgctccaaagggtcaattgttcacagcgatgcacttcattttatcaagtaa

DBGET integrated database retrieval system