KEGG   Mus musculus (mouse): 67528Help
Entry
67528             CDS       T01002                                 

Gene name
Nudt7, 1300007B24Rik, 2210404C19Rik
Definition
(RefSeq) nudix (nucleoside diphosphate linked moiety X)-type motif 7
  KO
K17879  peroxisomal coenzyme A diphosphatase NUDT7 [EC:3.6.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    67528 (Nudt7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     67528 (Nudt7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-GeneID: 67528
NCBI-ProteinID: NP_077757
MGI: 1914778
Ensembl: ENSMUSG00000031767
Vega: OTTMUSG00000027518
UniProt: Q99P30
Position
8; 8 E1
AA seq 236 aa AA seqDB search
MSRPCGLPEPVRNNLIDDAKARLRKSDVGTRYSHLSSNKFSVLVPLLARGGKLYLMFTVR
SDKLKREPGEVCFPGGKRDPVDTDDTATALREAQEEVGLHPHQVEVVSHLVPYVFDNDAL
VTPVVGFLDHNFQAQPNADEVKEVFFVPLDYFLHPQVYYQKQITQSGRDFIMHCFEYKDP
ETGVNYLIQGMTSKLAVLVALIILEQSPAFKIDFDLHDLIPSCERTFLWRYSLSKL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgaccttgtggactcccggagcctgtcagaaacaatctgatagatgatgccaag
gctcgcctgagaaagtctgatgtcgggaccagatattctcacctgtcctctaataaattc
tctgtccttgtaccactgctggccagaggaggaaagttgtatttgatgttcacggtccgc
tcagacaagctgaaaagggaacctggagaagtctgcttccctggaggaaagagggacccg
gtggacacagatgacacagccactgctctccgtgaagcccaggaggaggtggggctgcat
ccccaccaagtggaggtggtctctcacctggtgccatacgtatttgataatgatgcactg
gtaacccccgtagtgggttttctagaccacaacttccaggcccaacctaatgctgatgaa
gtgaaggaagtcttctttgtgcctttggactatttcctccatccccaagtctactaccag
aagcaaatcacacagtctggccgtgatttcatcatgcattgcttcgagtacaaagaccct
gagactggtgtgaactacctaatccagggaatgacctcaaaactggctgtgttggtggcc
ttaattattttggaacaaagtcctgccttcaagattgattttgatctccatgacctgata
ccgtcttgtgaaaggaccttcctttggagatattctttaagcaagttgtga

DBGET integrated database retrieval system