KEGG   Mus musculus (mouse): 67529Help
Entry
67529             CDS       T01002                                 

Gene name
Fgfr1op2, 1500031J01Rik
Definition
(RefSeq) FGFR1 oncogene partner 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: SIKE Tho2
Motif
Other DBs
NCBI-GeneID: 67529
NCBI-ProteinID: NP_080494
MGI: 1914779
Ensembl: ENSMUSG00000040242
Vega: OTTMUSG00000025705
UniProt: Q9CRA9
Position
6; 6 G3
AA seq 253 aa AA seqDB search
MSCTIEKALADAKALVERLRDHDDAAESLIEQTTALSKRVEAMKQYQEEIQELNEVARHR
PRSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDP
GIIMKLKEQHSKIDMVHRNSCEGFFLDASRHILEAPQHGLERRHLEANQNELQAHVDQIT
EMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLREILQITRESFLNLRKDDASESTSLS
ALVTNSDLSLRKS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcaccattgagaaggcacttgctgacgctaaagcccttgttgaaaggttgaga
gatcatgatgatgcagcagagtctctcatcgagcagaccactgccctcagcaagcgagtg
gaagcgatgaagcagtatcaggaggaaatccaagaacttaatgaagtagcaagacatcgg
ccacgatccacactagttatgggaatccagcaagaaaacagacaaatcagagaattacaa
caagaaaacaaagaactgcggacatccctggaagagcaccagtctgccctggaactgata
atgagcaagtaccgagagcagatgttcagactgctcatggccagcaagaaagatgaccca
ggtataataatgaagttaaaagagcaacactcaaagattgacatggtacatcgtaacagc
tgcgaaggattcttcctggatgcatctcggcacatccttgaagcacctcagcacggactg
gagaggaggcacttggaggcaaatcagaatgagttgcaagcacatgttgaccaaatcacc
gagatggcagcagtaatgagaaaagctattgaaattgacgagcagcagggttgcaaggaa
caggagcggatatttcaacttgaacaagaaaataaaggcttgagagagatccttcagata
actcgagaatcctttttgaaccttcggaaggatgatgcgtcagagagtacgtctctatct
gccttagtgactaacagtgacctgagtctgaggaagagctga

DBGET integrated database retrieval system