KEGG   Mus musculus (mouse): 67530
Entry
67530             CDS       T01002                                 

Gene name
Uqcrb, 2210415M14Rik, QP-, QP-C, QPC, UQBC, UQBP, UQPC
Definition
(RefSeq) ubiquinol-cytochrome c reductase binding protein
  KO
K00417  ubiquinol-cytochrome c reductase subunit 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    67530 (Uqcrb)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    67530 (Uqcrb)
  09159 Environmental adaptation
   04714 Thermogenesis
    67530 (Uqcrb)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    67530 (Uqcrb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67530 (Uqcrb)
   05012 Parkinson disease
    67530 (Uqcrb)
   05014 Amyotrophic lateral sclerosis
    67530 (Uqcrb)
   05016 Huntington disease
    67530 (Uqcrb)
   05020 Prion disease
    67530 (Uqcrb)
   05022 Pathways of neurodegeneration - multiple diseases
    67530 (Uqcrb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    67530 (Uqcrb)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    67530 (Uqcrb)
SSDB
Motif
Pfam: UCR_14kD
Other DBs
NCBI-GeneID: 67530
NCBI-ProteinID: NP_080495
MGI: 1914780
Ensembl: ENSMUSG00000021520
Vega: OTTMUSG00000037036
UniProt: Q9CQB4
Position
13; 13 B3
AA seq 111 aa
MAGRSAVSASSKWLDGFRKWYYNAAGFNKLGLMRDDTLHETEDVKEAIRRLPEDLYNDRM
FRIKRALDLTMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERKEREEWAKK
NT seq 336 nt   +upstreamnt  +downstreamnt
atggcgggccgatctgctgtttcagcatcaagcaagtggctggatggttttcgaaagtgg
tattataatgctgcaggattcaataaactggggttaatgcgagatgatacactacatgaa
actgaagatgtaaaagaagccataagaaggcttcctgaggacctttataatgacaggatg
tttcgaattaagagagccctggacctgactatgaggcatcagatcttgcctaaggatcag
tggacaaaatatgaggaggacaaattctaccttgaaccctatctaaaagaggttattcgg
gaaagaaaggagagagaagagtgggcaaagaagtga

DBGET integrated database retrieval system