KEGG   Mus musculus (house mouse): 67532
Entry
67532             CDS       T01002                                 
Symbol
Mfap1a, 4432409M24Rik, Mfap1, Mfap1b
Name
(RefSeq) microfibrillar-associated protein 1A
  KO
K13110  microfibrillar-associated protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    67532 (Mfap1a)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Complex B specific factors
    67532 (Mfap1a)
SSDB
Motif
Pfam: MFAP1
Other DBs
NCBI-GeneID: 67532
NCBI-ProteinID: NP_080496
MGI: 1914782
Ensembl: ENSMUSG00000068479
Vega: OTTMUSG00000015375
UniProt: C0HKD8 C0HKD9
Position
2:complement(121323162..121337137)
AA seq 439 aa
MSVPSALMKQPPIQSTAGAVPVRNEKGEISMEKVKVKRYVSGKRPDYAPMESSDEEDEEF
QFIKKAKEQEAEPEEQEEDSSSDPRLRRLQNRISEDVEERLARHRKIVEPEVVGESDSEV
EGDAWRLEREDSSEEEEEEIDDEEIERRRGMMRQRAQERKNEEMEVMEVEDEGRSGEESE
SESEYEEYTDSEDEMEPRLKPVFIRKKDRVTVQEREAEALKQKELEQEAKRMAEERRKYT
LKIVEEETKKELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKREREDREALEKE
KAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDF
SAPTLEDHFNKTILPKVMQVKNFGRSGRTKYTHLVDQDTTSFDSAWGQESAQNTKFFKQK
AAGVRDVFERPSAKKRKTT
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgtcggtcccaagcgcactcatgaagcagccgcccatccagtctacggctggggccgtc
ccagttcgaaacgagaaaggtgagatctcaatggaaaaggtgaaggtgaaacgatatgtg
tccggaaagagaccagattatgcccctatggagtcctcagatgaagaggatgaagaattt
cagttcattaagaaagctaaggaacaagaagcagagcctgaggaacaggaggaggactca
tccagtgacccccgacttcggcggttacagaaccgcatcagtgaagatgtggaagagcga
ttggctcgacacagaaagatcgtggaacctgaagtagtgggagagagcgactcagaagta
gaaggggatgcttggcgcctggaacgagaagacagcagtgaggaagaggaggaagagatt
gacgatgaagaaattgagcggcgccgtggcatgatgcgtcagcgagcacaggagaggaaa
aatgaagagatggaagtcatggaggtggaagatgaagggcgctctggggaggagtctgag
tcagagtctgagtatgaggagtacacagacagtgaggatgaaatggagcctcgacttaag
cctgtcttcattcgaaagaaggatcgggtgacagttcaagaacgagaagctgaagcattg
aaacagaaggaactggaacaagaagcaaaacgcatggctgaggagcggcgcaagtacacc
ctcaagattgtagaagaagagaccaagaaagagctagaggagaacaagcggtctcttgct
gccctggatgcgctcaatactgatgatgaaaatgacgaggaagaatacgaggcatggaaa
gtccgcgagctcaaaagaatcaagagggagagagaagaccgagaagcgcttgaaaaggag
aaagcagaaattgaacgcatgagaaacctgactgaggaagaaaggcgggcagaacttcgg
gcaaatggcaaagtcattaccaacaaagctgttaaaggcaaatacaagtttctacagaag
tattatcaccgaggtgccttcttcatggatgaggatgaagaagtctacaagagagacttt
agtgcacctactcttgaggaccatttcaacaaaaccattcttcctaaagtcatgcaggtc
aagaattttggacggtctggtcgcaccaagtacacccaccttgtggatcaagataccact
tcctttgactctgcatggggccaagagagtgcccagaacacaaaattctttaaacaaaag
gcagcaggggtacgagatgtatttgagcgaccatctgccaagaagaggaaaaccacctag

DBGET integrated database retrieval system